• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nuclear receptor subfamily 3, group C, member 2 (NR3C2), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23079 Homo sapiens nuclear receptor subfamily 3, group C, member 2 (NR3C2), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu23079C Homo sapiens nuclear receptor subfamily 3, group C, member 2 (NR3C2), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000901.4, 260656018
Length 2955 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens nuclear receptor subfamily 3, group C, member 2 (NR3C2), transcript variant 1, mRNA.
Product mineralocorticoid receptor isoform 1
Comment

Summary: This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000892.2
CDS 364..3318
Misc Feature(1)277..279
Misc Feature(2)364..2169
Misc Feature(3)364..2169
Misc Feature(4)874..>1461
Misc Feature(5)2158..2382
Misc Feature(6)order(2170..2172,2179..2181,2221..2223,2230..2232,
Misc Feature(7)order(2200..2208,2224..2229,2233..2238,2245..2250,
Misc Feature(8)order(2275..2283,2287..2289,2296..2301,2311..2316,
Misc Feature(9)2368..2559
Misc Feature(10)2560..3315
Misc Feature(11)2572..3315
Misc Feature(12)order(2668..2673,2677..2682,2689..2691,2782..2784,
Misc Feature(13)order(2695..2697,2704..2709,2716..2718,2746..2748,
Misc Feature(14)2707..2718
Misc Feature(15)order(3040..3042,3049..3051,3061..3063,3097..3108,
Exon (1)1..361
Gene:NR3C2
Gene Synonym:MCR; MLR; MR; NR3C2VIT
Exon (2)362..2120
Gene:NR3C2
Gene Synonym:MCR; MLR; MR; NR3C2VIT
Exon (3)2121..2260
Gene:NR3C2
Gene Synonym:MCR; MLR; MR; NR3C2VIT
Exon (4)2261..2377
Gene:NR3C2
Gene Synonym:MCR; MLR; MR; NR3C2VIT
Exon (5)2378..2728
Gene:NR3C2
Gene Synonym:MCR; MLR; MR; NR3C2VIT
Exon (6)2729..2873
Gene:NR3C2
Gene Synonym:MCR; MLR; MR; NR3C2VIT
Exon (7)2874..3004
Gene:NR3C2
Gene Synonym:MCR; MLR; MR; NR3C2VIT
Exon (8)3005..3162
Gene:NR3C2
Gene Synonym:MCR; MLR; MR; NR3C2VIT
Exon (9)3163..5898
Gene:NR3C2
Gene Synonym:MCR; MLR; MR; NR3C2VIT
Translation METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNST QGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYE QQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAV VKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPN VENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVP SPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF DGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL QKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVN TALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQV VKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYI KELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAML VEIISDQLPKVESGNAKPLYFHRK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(33)-dbSNP:
complement(33)-g, cdbSNP:72646915
complement(34)-g, adbSNP:72646914
complement(63)-g, cdbSNP:61760023
complement(82)-g, cdbSNP:112500486
complement(89)-g, adbSNP:61760022
complement(212)-g, cdbSNP:190427520
complement(222)-g, cdbSNP:184722093
complement(320)-g, adbSNP:367712600
complement(356)-t, adbSNP:61760021
362+dbSNP:
362+c, gdbSNP:2070951
complement(394)-t, cdbSNP:374014545
complement(431)-g, adbSNP:369152607
complement(433)-g, adbSNP:138833427
complement(446)-t, g, cdbSNP:72645689
complement(466)-g, cdbSNP:141860706
complement(474)-t, gdbSNP:374801931
complement(491)-g, adbSNP:61760013
complement(503)-t, cdbSNP:199942132
complement(525)-g, adbSNP:61760012
complement(529)-g, cdbSNP:368078532
complement(531)-t, adbSNP:61760011
complement(535)-t, adbSNP:61760010
complement(538)-t, adbSNP:61760009
complement(596)-t, cdbSNP:374204565
complement(618)-t, cdbSNP:148089711
complement(647)-t, cdbSNP:182568851
complement(728)-t, cdbSNP:147024247
complement(743)-t, cdbSNP:141462272
complement(768)-g, cdbSNP:138893620
complement(788)-t, gdbSNP:372454781
812+a, gdbSNP:13306591
complement(812)-t, cdbSNP:386528016
complement(819)-g, adbSNP:368542003
complement(839)-g, adbSNP:200698285
complement(849)-t, cdbSNP:138971877
851+c, gdbSNP:121912568
complement(876)-g, adbSNP:146027424
complement(895)-g, adbSNP:375487193
complement(896)-t, cdbSNP:371233416
complement(897)-g, adbSNP:201996429
complement(900)-g, adbSNP:145148455
901+a, gdbSNP:5522
complement(912)-g, adbSNP:369752535
complement(918)-g, adbSNP:72645688
complement(938)-t, gdbSNP:201155740
complement(990)-t, adbSNP:370008309
complement(1006)-t, adbSNP:72645687
complement(1027)-t, adbSNP:374672844
complement(1094)-t, cdbSNP:72645686
complement(1102)-t, adbSNP:149902988
complement(1130)-t, cdbSNP:72645685
complement(1155)-t, cdbSNP:192001093
complement(1163)-g, cdbSNP:146671580
complement(1185)-g, cdbSNP:186788495
complement(1195)-g, adbSNP:201919373
complement(1257)-g, adbSNP:138498293
complement(1338)-t, cdbSNP:371390364
complement(1341)-t, cdbSNP:143126546
complement(1429)-g, adbSNP:369092774
complement(1433)-t, gdbSNP:201740390
complement(1455)-t, cdbSNP:61729559
complement(1513)-t, gdbSNP:146386941
complement(1555)-t, cdbSNP:371818595
complement(1568)-g, adbSNP:143847779
complement(1619)-g, adbSNP:72645628
complement(1632)-g, adbSNP:200381347
complement(1635)-t, cdbSNP:368453653
complement(1668)-t, cdbSNP:140710365
1671+a, tdbSNP:121912570
complement(1694)-c, adbSNP:5523
complement(1726)-t, cdbSNP:375627544
complement(1730)-g, adbSNP:12509135
complement(1731)-t, cdbSNP:72645627
complement(1743)-t, adbSNP:149589666
1761+c, tdbSNP:5524
complement(1800)-g, adbSNP:147461426
complement(1821)-g, adbSNP:372856184
complement(1825)-t, cdbSNP:374732530
complement(1860)-g, adbSNP:5525
complement(1872)-g, adbSNP:138960832
complement(1939)-t, adbSNP:199724634
1972+c, g, tdbSNP:121912562
1973+a, gdbSNP:5526
complement(1973)-g, adbSNP:386598923
complement(1977)-t, cdbSNP:146153919
complement(1978)-c, adbSNP:72645626
complement(2014)-g, cdbSNP:72645625
complement(2023)-t, adbSNP:148037179
complement(2024)-g, adbSNP:5527
complement(2052)-t, cdbSNP:5528
complement(2053)-t, cdbSNP:370304738
complement(2055)-g, adbSNP:188602841
complement(2058)-g, adbSNP:367866488
complement(2064)-t, cdbSNP:374749484
complement(2068)-t, cdbSNP:61759976
complement(2076)-g, adbSNP:5529
complement(2086)-g, adbSNP:140796742
2136+dbSNP:
2136+c, tdbSNP:55914141
complement(2154)-g, adbSNP:34905604
complement(2184)-c, adbSNP:62332038
complement(2213)-g, adbSNP:373194830
complement(2248)-t, gdbSNP:182277096
2260+a, gdbSNP:121912566
2298+dbSNP:
2298+a, cdbSNP:121912564
complement(2316)-t, cdbSNP:72653855
complement(2337)-g, adbSNP:201232560
2380+dbSNP:
2380+c, tdbSNP:121912571
2387+c, gdbSNP:121912572
complement(2434)-g, cdbSNP:374750873
complement(2445)-g, adbSNP:202017956
complement(2450)-g, adbSNP:368322580
complement(2489)-g, adbSNP:139938639
complement(2502)-g, adbSNP:151096115
complement(2517)-t, cdbSNP:200085890
complement(2537)-g, adbSNP:374834477
complement(2541)-t, cdbSNP:144234574
complement(2545)-g, adbSNP:369389025
complement(2603)-g, adbSNP:62332228
complement(2649)-g, adbSNP:147478460
complement(2673)-g, adbSNP:376341327
complement(2674)-g, adbSNP:201310587
complement(2675)-t, cdbSNP:143057152
2690+a, gdbSNP:121912565
complement(2790)-dbSNP:
complement(2790)-t, cdbSNP:145670736
2792+c, tdbSNP:41511344
2816+c, tdbSNP:121912573
complement(2829)-t, cdbSNP:368406158
2840+a, tdbSNP:13306592
complement(2940)-dbSNP:
complement(2940)-g, adbSNP:140705228
complement(2941)-t, cdbSNP:147398624
complement(2983)-t, cdbSNP:375009299
complement(3060)-dbSNP:
complement(3060)-g, adbSNP:199889429
complement(3087)-g, adbSNP:369982195
complement(3098)-t, cdbSNP:149541750
3134+c, tdbSNP:121912563
complement(3153)-g, adbSNP:375772941
complement(3162)-g, adbSNP:371422334
complement(3171)-dbSNP:
complement(3171)-g, adbSNP:112365566
3202+c, tdbSNP:121912569
complement(3252)-g, adbSNP:377077242
3278+a, gdbSNP:121912574
complement(3284)-t, cdbSNP:267600035
3299+c, tdbSNP:121912567
complement(3307)-g, adbSNP:138068105
complement(3311)-t, cdbSNP:183046347
complement(3324)-g, adbSNP:373627783
complement(3331)-t, gdbSNP:367784604
complement(3336)-g, cdbSNP:192823416
complement(3353..3354)-, gdbSNP:35832836
complement(3404)-t, cdbSNP:5530
complement(3425..3427)-, aacdbSNP:373725420
complement(3541)-t, cdbSNP:187968743
complement(3643)-t, cdbSNP:201950852
complement(3646)-c, adbSNP:139673876
complement(3659)-g, adbSNP:375531881
complement(3663)-g, adbSNP:183012834
complement(3702)-t, gdbSNP:72648711
complement(3730)-g, adbSNP:17024360
complement(3768..3769)-, tdbSNP:72648710
complement(3785..3790)-attat, tattat, adbSNP:63748994
complement(3790)-, tdbSNP:397779293
complement(3796)-, tdbSNP:10708334
complement(3796)-t, adbSNP:367671450
complement(3802)-t, cdbSNP:72648709
complement(3833)-c, adbSNP:77646785
4026+c, gdbSNP:5531
complement(4057..4058)-, atttdbSNP:72648708
complement(4073)-c, adbSNP:5532
complement(4122)-c, adbSNP:72648707
complement(4208)-c, adbSNP:72648706
complement(4216)-c, adbSNP:35586342
complement(4223)-c, adbSNP:377394076
complement(4316)-t, adbSNP:35396139
complement(4350)-t, cdbSNP:61763141
complement(4354)-t, cdbSNP:72648705
complement(4369)-g, adbSNP:72648704
complement(4439)-g, adbSNP:114071155
complement(4483)-t, cdbSNP:5533
complement(4527)-t, cdbSNP:118144639
complement(4572)-t, cdbSNP:371230099
complement(4596)-t, cdbSNP:61763140
complement(4609)-t, cdbSNP:61763139
complement(4641..4642)-, atgdbSNP:376591858
complement(4651)-g, adbSNP:190695140
complement(4670)-t, cdbSNP:186795361
complement(4703..4704)-, agdbSNP:61763138
complement(4724)-t, adbSNP:61763137
4728+a, gdbSNP:5534
4760+c, tdbSNP:1062595
complement(4770)-g, adbSNP:181282602
complement(4771)-t, cdbSNP:61763136
4826+a, gdbSNP:5535
complement(4855..4856)-, atctdbSNP:371584659
complement(4862..4863)-, tctadbSNP:140789678
complement(4895..4896)-, attdbSNP:72648703
complement(4983..4986)-, aacadbSNP:72647602
complement(4983..4986)-, aacadbSNP:398088156
complement(4989..4992)-, caaadbSNP:146592484
complement(5042..5043)-, gatadbSNP:367747835
complement(5047..5048)-, agatdbSNP:199601327
complement(5092)-t, cdbSNP:377659495
complement(5120)-g, adbSNP:5536
complement(5154..5157)-, taatdbSNP:398088155
complement(5157..5158)-, aatdbSNP:72647601
complement(5158..5161)-, taatdbSNP:66815369
complement(5161..5163)-, aatdbSNP:200474868
complement(5243)-t, cdbSNP:373062764
5338+c, tdbSNP:1062596
complement(5383)-t, gdbSNP:72647600
complement(5390)-t, gdbSNP:138287185
complement(5406)-t, cdbSNP:145711262
complement(5475..5476)-, tttgdbSNP:372714993
complement(5494..5497)-, ttgtdbSNP:72647599
complement(5561..5562)-, cdbSNP:34293064
complement(5589)-g, adbSNP:140644495
5706+c, tdbSNP:5537
complement(5728)-g, adbSNP:186309103
5789+a, gdbSNP:2871
Gene SymbolNR3C2
Gene SynonymMCR; MLR; MR; NR3C2VIT
Chromosome4
Locus Map4q31.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001166104 Homo sapiens nuclear receptor subfamily 3, group C, member 2 (NR3C2), transcript variant 2, mRNA. On-demand $279.00 12-14
NM_000901 Homo sapiens nuclear receptor subfamily 3, group C, member 2 (NR3C2), transcript variant 1, mRNA. On-demand $279.00 12-14
XM_005263014 PREDICTED: Homo sapiens nuclear receptor subfamily 3, group C, member 2 (NR3C2), transcript variant X1, mRNA. On-demand $279.00 12-14
XM_006714222 PREDICTED: Homo sapiens nuclear receptor subfamily 3, group C, member 2 (NR3C2), transcript variant X2, mRNA. On-demand $279.00 12-14
Title Genome-wide analysis of murine renal distal convoluted tubular cells for the target genes of mineralocorticoid receptor .
Author Ueda K, Fujiki K, Shirahige K, Gomez-Sanchez CE, Fujita T, Nangaku
Journal Biochem. Biophys. Res. Commun. 445 (1), 132-137 (2014)
Title MR and GR functional SNPs may modulate tobacco smoking susceptibility .
Author Rovaris DL, Mota NR, de Azeredo LA, Cupertino RB, Bertuzzi GP, Polina ER, Contini V, Kortmann GL, Vitola ES, Grevet EH, Grassi-Oliveira R, Callegari-Jacques SM and Bau CH.
Journal J Neural Transm 120 (10), 1499-1505 (2013)
Title Cardiovascular effects of aldosterone: insight from adult carriers of mineralocorticoid receptor mutations .
Author Escoubet B, Couffignal C, Laisy JP, Mangin L, Chillon S, Laouenan C, Serfaty JM, Jeunemaitre X, Mentre F and Zennaro MC.
Journal Circ Cardiovasc Genet 6 (4), 381-390 (2013)
Title The decrease of mineralcorticoid receptor drives angiogenic pathways in colorectal cancer .
Author Tiberio L, Nascimbeni R, Villanacci V, Casella C, Fra A, Vezzoli V, Furlan L, Meyer G, Parrinello G, Baroni MD, Salerni B and Schiaffonati L.
Journal PLoS ONE 8 (3), E59410 (2013)
Title A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function .
Author Porcu E, Medici M, Pistis G, Volpato CB, Wilson SG, Cappola AR, Bos SD, Deelen J, den Heijer M, Freathy RM, Lahti J, Liu C, Lopez LM, Nolte IM, O'Connell JR, Tanaka T, Trompet S, Arnold A, Bandinelli S, Beekman M, Bohringer S, Brown SJ, Buckley BM, Camaschella C, de Craen AJ, Davies G, de Visser MC, Ford I, Forsen T, Frayling TM, Fugazzola L, Gogele M, Hattersley AT, Hermus AR, Hofman A, Houwing-Duistermaat JJ, Jensen RA, Kajantie E, Kloppenburg M, Lim EM, Masciullo C, Mariotti S, Minelli C, Mitchell BD, Nagaraja R, Netea-Maier RT, Palotie A, Persani L, Piras MG, Psaty BM, Raikkonen K, Richards JB, Rivadeneira F, Sala C, Sabra MM, Sattar N, Shields BM, Soranzo N, Starr JM, Stott DJ, Sweep FC, Usala G, van der Klauw MM, van Heemst D, van Mullem A, Vermeulen SH, Visser WE, Walsh JP, Westendorp RG, Widen E, Zhai G, Cucca F, Deary IJ, Eriksson JG, Ferrucci L, Fox CS, Jukema JW, Kiemeney LA, Pramstaller PP, Schlessinger D, Shuldiner AR, Slagboom EP, Uitterlinden AG, Vaidya B, Visser TJ, Wolffenbuttel BH, Meulenbelt I, Rotter JI, Spector TD, Hicks AA, Toniolo D, Sanna S, Peeters RP and Naitza S.
Journal PLoS Genet. 9 (2), E1003266 (2013)
Title Identification of a splice variant of the rat and human mineralocorticoid receptor genes .
Author Bloem LJ, Guo C and Pratt JH.
Journal J. Steroid Biochem. Mol. Biol. 55 (2), 159-162 (1995)
Title Overexpression and characterization of the human mineralocorticoid receptor .
Author Alnemri ES, Maksymowych AB, Robertson NM and Litwack G.
Journal J. Biol. Chem. 266 (27), 18072-18081 (1991)
Title Regional chromosomal assignment of the human mineralocorticoid receptor gene to 4q31.1 .
Author Morrison N, Harrap SB, Arriza JL, Boyd E and Connor JM.
Journal Hum. Genet. 85 (1), 130-132 (1990)
Title The human mineralocorticoid receptor gene (MLR) is located on chromosome 4 at q31.2 .
Author Fan YS, Eddy RL, Byers MG, Haley LL, Henry WM, Nowak NJ and Shows TB.
Journal Cytogenet. Cell Genet. 52 (1-2), 83-84 (1989)
Title Cloning of human mineralocorticoid receptor complementary DNA: structural and functional kinship with the glucocorticoid receptor .
Author Arriza,J.L., Weinberger,C., Cerelli,G., Glaser,T.M., Handelin,B.L., Housman,D.E. and Evans,R.M.
Journal Science 237 (4812), 268-275 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.