• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu29784 Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu29784C Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000910.2, 27552771
Length 1146 bp
Structure linear
Update Date 26-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA.
Product neuropeptide Y receptor type 2
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from U42766.1. On Jan 9, 2003 this sequence version replaced gi:4505446.

RefSeq NP_000901.1
CDS 496..1641
Misc Feature(1)379..381
Misc Feature(2)649..711
Misc Feature(3)649..711
Misc Feature(4)676..1515
Misc Feature(5)715..1470
Misc Feature(6)754..816
Misc Feature(7)868..930
Misc Feature(8)991..1053
Misc Feature(9)1144..1206
Misc Feature(10)1300..1362
Misc Feature(11)1408..1470
Translation MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK KNLEVRKNSGPNDSFTEATNV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
331+dbSNP:
331+c, tdbSNP:72972775
360+c, tdbSNP:113342908
397+a, gdbSNP:374970572
445+g, tdbSNP:188592971
452+c, tdbSNP:41280479
466+g, tdbSNP:185914818
474+a, gdbSNP:201478749
553+g, tdbSNP:374058599
559+c, tdbSNP:142187929
561+c, tdbSNP:111278234
600+c, tdbSNP:371976710
609+a, tdbSNP:150101539
630+a, gdbSNP:201656988
631+a, cdbSNP:201188890
640+a, gdbSNP:374458370
654+a, gdbSNP:2342674
675+a, cdbSNP:142772765
692+c, tdbSNP:147403709
714+c, tdbSNP:138139550
741+c, tdbSNP:149532287
754+a, tdbSNP:144160377
796+a, gdbSNP:199763071
810+g, tdbSNP:148709959
823+c, tdbSNP:368651795
856+g, tdbSNP:372447584
861+a, gdbSNP:375830367
870+a, gdbSNP:267600055
888+c, tdbSNP:141417330
891+a, gdbSNP:201937520
937+c, tdbSNP:199805893
948+c, tdbSNP:367841999
952+a, gdbSNP:146320853
1005+c, tdbSNP:139612664
1008+g, tdbSNP:202152711
1009+a, gdbSNP:200831948
1025+c, tdbSNP:144347274
1026+c, tdbSNP:372596575
1064+c, tdbSNP:151197683
1065+a, gdbSNP:375788979
1080+c, tdbSNP:1047214
1122+c, tdbSNP:369176614
1123+a, gdbSNP:372918535
1149+c, gdbSNP:61741797
1164+c, tdbSNP:375533723
1174+c, tdbSNP:149843372
1198+a, gdbSNP:376163169
1217+a, g, tdbSNP:201834148
1228+a, gdbSNP:145866617
1242+c, tdbSNP:149021972
1306+g, tdbSNP:369993579
1328+c, tdbSNP:143021899
1366+a, gdbSNP:147783618
1422+c, gdbSNP:374553448
1425+c, gdbSNP:141206009
1431+a, gdbSNP:2880415
1448+c, gdbSNP:190323408
1473+c, tdbSNP:138080356
1508+c, tdbSNP:201907812
1516+c, tdbSNP:201784122
1528+c, tdbSNP:376048056
1529+a, gdbSNP:141746382
1542+g, tdbSNP:150154882
1558+a, gdbSNP:201560340
1577+a, gdbSNP:148440232
1605+a, cdbSNP:138652181
1610+a, gdbSNP:368830127
1632+a, cdbSNP:78958722
1659+a, gdbSNP:370964405
1690+a, gdbSNP:199521122
1880+a, tdbSNP:188132230
1889..1890+, adbSNP:368754034
1953..1955+, tatdbSNP:369509939
2001+c, tdbSNP:190921987
2012+a, cdbSNP:145077448
2155+c, gdbSNP:142358900
2180+c, gdbSNP:182746502
2386+a, gdbSNP:376216837
2440+c, tdbSNP:112557709
2467+g, tdbSNP:369043698
2480+g, tdbSNP:193243702
2512+a, cdbSNP:146356210
2581+a, gdbSNP:147914972
2656+c, tdbSNP:141658548
2657+a, gdbSNP:116026747
2922+a, gdbSNP:183247022
2923+a, tdbSNP:112683521
3025..3026+, acdbSNP:201748517
3064+a, gdbSNP:187520987
3105+c, tdbSNP:192041437
3174+c, tdbSNP:112790814
3200+c, tdbSNP:113369271
3259+g, tdbSNP:207465180
3291+a, gdbSNP:375435169
3313+a, gdbSNP:184224545
3386+, adbSNP:35280113
3401+c, tdbSNP:189777347
Gene SymbolNPY2R
Gene SynonymNPY2-R
Chromosome4
Locus Map4q31
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000910 Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA. On-demand $219.00 7-9
NM_000910 Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA. On-demand $219.00 7-9
NM_000910 Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA. On-demand $219.00 7-9
Title Heredity and cardiometabolic risk: naturally occurring polymorphisms in the human neuropeptide Y(2) receptor promoter disrupt multiple transcriptional response motifs .
Author Wei Z, Zhang K, Wen G, Balasubramanian K, Shih PA, Rao F, Friese RS, Miramontes-Gonzalez JP, Schmid-Schoenbein GW, Kim HS, Mahata SK and O'Connor DT.
Journal J. Hypertens. 31 (1), 123-133 (2013)
Title The anterograde transport of the human neuropeptide Y2 receptor is regulated by a subtype specific mechanism mediated by the C-terminus .
Author Walther C, Lotze J, Beck-Sickinger AG and Morl K.
Journal Neuropeptides 46 (6), 335-343 (2012)
Title Surface masking shapes the traffic of the neuropeptide Y Y2 receptor .
Author Parker MS, Sah R and Parker SL.
Journal Peptides 37 (1), 40-48 (2012)
Title Fluorescence correlation spectroscopy, combined with bimolecular fluorescence complementation, reveals the effects of beta-arrestin complexes and endocytic targeting on the membrane mobility of neuropeptide Y receptors .
Author Kilpatrick LE, Briddon SJ and Holliday ND.
Journal Biochim. Biophys. Acta 1823 (6), 1068-1081 (2012)
Title Neuropeptide Y2 receptor (NPY2R) expression in saliva predicts feeding immaturity in the premature neonate .
Author Maron JL, Johnson KL, Dietz JA, Chen ML and Bianchi DW.
Journal PLoS ONE 7 (5), E37870 (2012)
Title Expression cloning and pharmacological characterization of a human hippocampal neuropeptide Y/peptide YY Y2 receptor subtype .
Author Gerald C, Walker MW, Vaysse PJ, He C, Branchek TA and Weinshank RL.
Journal J. Biol. Chem. 270 (45), 26758-26761 (1995)
Title Cloning and functional expression of a cDNA encoding a human type 2 neuropeptide Y receptor .
Author Rose PM, Fernandes P, Lynch JS, Frazier ST, Fisher SM, Kodukula K, Kienzle B and Seethala R.
Journal J. Biol. Chem. 270 (39), 22661-22664 (1995)
Title A pertussis toxin-insensitive calcium influx mediated by neuropeptide Y2 receptors in a human neuroblastoma cell line .
Author Lynch JW, Lemos VS, Bucher B, Stoclet JC and Takeda K.
Journal J. Biol. Chem. 269 (11), 8226-8233 (1994)
Title Cloned human neuropeptide Y receptor couples to two different second messenger systems .
Author Herzog H, Hort YJ, Ball HJ, Hayes G, Shine J and Selbie LA.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (13), 5794-5798 (1992)
Title Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs .
Author Itoh H, Toyama R, Kozasa T, Tsukamoto T, Matsuoka M and Kaziro Y.
Journal J. Biol. Chem. 263 (14), 6656-6664 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.