• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA.


RefSeq Accession Definition Services Price Order
NM_000910 Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA. ORF Sequence $332.34
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000910.2, 27552771
Length 3747 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA.
Product neuropeptide Y receptor type 2
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from U42766.1. On Jan 9, 2003 this sequence version replaced gi:4505446.

RefSeq NP_000901.1
CDS 496..1641
Misc Feature(1)379..381
Misc Feature(2)649..711
Misc Feature(3)649..711
Misc Feature(4)676..1515
Misc Feature(5)715..1470
Misc Feature(6)754..816
Misc Feature(7)868..930
Misc Feature(8)991..1053
Misc Feature(9)1144..1206
Misc Feature(10)1300..1362
Misc Feature(11)1408..1470
Translation MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK KNLEVRKNSGPNDSFTEATNV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1577+a, gdbSNP:148440232
Gene SymbolNPY2R
Gene SynonymNPY2-R
Chromosome4
Locus Map4q31
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000910 Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA. Full Length $1311.45
ORF Sequence $332.34
Title Surface masking shapes the traffic of the neuropeptide Y Y2 receptor .
Author Parker,M.S., Sah,R. and Parker,S.L.
Journal Peptides 37 (1), 40-48 (2012)
Title Fluorescence correlation spectroscopy, combined with bimolecular fluorescence complementation, reveals the effects of beta-arrestin complexes and endocytic targeting on the membrane mobility of neuropeptide Y receptors .
Author Kilpatrick,L.E., Briddon,S.J. and Holliday,N.D.
Journal Biochim. Biophys. Acta 1823 (6), 1068-1081 (2012)
Title Neuropeptide Y2 receptor (NPY2R) expression in saliva predicts feeding immaturity in the premature neonate .
Author Maron,J.L., Johnson,K.L., Dietz,J.A., Chen,M.L. and Bianchi,D.W.
Journal PLoS ONE 7 (5), E37870 (2012)
Title Assessment of a fully active class A G protein-coupled receptor isolated from in vitro folding .
Author Bosse,M., Thomas,L., Hassert,R., Beck-Sickinger,A.G., Huster,D. and Schmidt,P.
Journal Biochemistry 50 (45), 9817-9825 (2011)
Title Polymorphisms in the NPY2R gene show significant associations with .
Author Hunt,S.C., Hasstedt,S.J., Xin,Y., Dalley,B.K., Milash,B.A., Yakobson,E., Gress,R.E., Davidson,L.E. and Adams,T.D.
Journal Obesity (Silver Spring) 19 (11), 2241-2247 (2011)
Title Expression cloning and pharmacological characterization of a human hippocampal neuropeptide Y/peptide YY Y2 receptor subtype .
Author Gerald,C., Walker,M.W., Vaysse,P.J., He,C., Branchek,T.A. and Weinshank,R.L.
Journal J. Biol. Chem. 270 (45), 26758-26761 (1995)
Title Cloning and functional expression of a cDNA encoding a human type 2 neuropeptide Y receptor .
Author Rose,P.M., Fernandes,P., Lynch,J.S., Frazier,S.T., Fisher,S.M., Kodukula,K., Kienzle,B. and Seethala,R.
Journal J. Biol. Chem. 270 (39), 22661-22664 (1995)
Title A pertussis toxin-insensitive calcium influx mediated by neuropeptide Y2 receptors in a human neuroblastoma cell line .
Author Lynch,J.W., Lemos,V.S., Bucher,B., Stoclet,J.C. and Takeda,K.
Journal J. Biol. Chem. 269 (11), 8226-8233 (1994)
Title Cloned human neuropeptide Y receptor couples to two different second messenger systems .
Author Herzog,H., Hort,Y.J., Ball,H.J., Hayes,G., Shine,J. and Selbie,L.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (13), 5794-5798 (1992)
Title Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs .
Author Itoh,H., Toyama,R., Kozasa,T., Tsukamoto,T., Matsuoka,M. and Kaziro,Y.
Journal J. Biol. Chem. 263 (14), 6656-6664 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878