• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_000910 Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA. Full Lenth $1311.45
ORF Sequence $332.34


RefSeq Version NM_000910.2, 27552771
Length 3747 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens neuropeptide Y receptor Y2 (NPY2R), mRNA.
Product neuropeptide Y receptor type 2
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from U42766.1. On Jan 9, 2003 this sequence version replaced gi:4505446.

RefSeq NP_000901.1
CDS 496..1641
Exon (1)8..447
Exon (2)8..447
Exon (3)448..3632
Translation MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK KNLEVRKNSGPNDSFTEATNV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
331+c, tdbSNP:72972775
360+c, tdbSNP:113342908
452+c, tdbSNP:41280479
561+c, tdbSNP:111278234
complement(654)-g, adbSNP:2342674
789+g, tdbSNP:74769617
1080+c, tdbSNP:1047214
1149+c, gdbSNP:61741797
complement(1431)-g, adbSNP:2880415
1632+a, cdbSNP:78958722
2440+c, tdbSNP:112557709
2657+a, gdbSNP:116026747
2923+a, tdbSNP:112683521
3174+c, tdbSNP:112790814
3200+c, tdbSNP:113369271
3386+, adbSNP:35280113
Gene SymbolNPY2R
Gene SynonymNPY2R
Chromosome4
Locus Map4q31
All Transcripts NM_000910
Title Ligand-induced internalization and recycling of the human neuropeptide Y2 receptor is regulated by its carboxyl-terminal tail .
Author Walther,C., Nagel,S., Gimenez,L.E., Morl,K., Gurevich,V.V. and Beck-Sickinger,A.G.
Journal J. Biol. Chem. 285 (53), 41578-41590 (2010)
Title Association between neuropeptide Y receptor 2 polymorphism and the smoking behavior of elderly Japanese .
Author Sato,N., Kageyama,S., Chen,R., Suzuki,M., Mori,H., Tanioka,F., Yamada,H., Kamo,T., Tao,H., Shinmura,K., Nozawa,A. and Sugimura,H.
Journal J. Hum. Genet. 55 (11), 755-760 (2010)
Title Neuropeptide Y and its Y2 receptor: potential targets in neuroblastoma therapy .
Author Lu,C., Everhart,L., Tilan,J., Kuo,L., Sun,C.C., Munivenkatappa,R.B., Jonsson-Rylander,A.C., Sun,J., Kuan-Celarier,A., Li,L., Abe,K., Zukowska,Z., Toretsky,J.A. and Kitlinska,J.
Journal Oncogene 29 (41), 5630-5642 (2010)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Candidate molecular pathway genes related to appetite regulatory neural network, adipocyte homeostasis and obesity: results from the .
Author Friedlander,Y., Li,G., Fornage,M., Williams,O.D., Lewis,C.E., Schreiner,P., Pletcher,M.J., Enquobahrie,D., Williams,M. and Siscovick,D.S.
Journal Ann. Hum. Genet. 74 (5), 387-398 (2010)
Title Expression cloning and pharmacological characterization of a human hippocampal neuropeptide Y/peptide YY Y2 receptor subtype .
Author Gerald,C., Walker,M.W., Vaysse,P.J., He,C., Branchek,T.A. and Weinshank,R.L.
Journal J. Biol. Chem. 270 (45), 26758-26761 (1995)
Title Cloning and functional expression of a cDNA encoding a human type 2 neuropeptide Y receptor .
Author Rose,P.M., Fernandes,P., Lynch,J.S., Frazier,S.T., Fisher,S.M., Kodukula,K., Kienzle,B. and Seethala,R.
Journal J. Biol. Chem. 270 (39), 22661-22664 (1995)
Title A pertussis toxin-insensitive calcium influx mediated by neuropeptide Y2 receptors in a human neuroblastoma cell line .
Author Lynch,J.W., Lemos,V.S., Bucher,B., Stoclet,J.C. and Takeda,K.
Journal J. Biol. Chem. 269 (11), 8226-8233 (1994)
Title Cloned human neuropeptide Y receptor couples to two different second messenger systems .
Author Herzog,H., Hort,Y.J., Ball,H.J., Hayes,G., Shine,J. and Selbie,L.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (13), 5794-5798 (1992)
Title Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs .
Author Itoh,H., Toyama,R., Kozasa,T., Tsukamoto,T., Matsuoka,M. and Kaziro,Y.
Journal J. Biol. Chem. 263 (14), 6656-6664 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878