• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens peptidylprolyl isomerase B (cyclophilin B) (PPIB), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19649 Homo sapiens peptidylprolyl isomerase B (cyclophilin B) (PPIB), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19649C Homo sapiens peptidylprolyl isomerase B (cyclophilin B) (PPIB), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000942.4, 44890060
Length 651 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens peptidylprolyl isomerase B (cyclophilin B) (PPIB), mRNA.
Product peptidyl-prolyl cis-trans isomerase B precursor
Comment

Summary: The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Variants have been identified in this protein that give rise to recessive forms of osteogenesis imperfecta. [provided by RefSeq, Oct 2009].

RefSeq NP_000933.1
CDS 170..820
Misc Feature(1)302..778
Misc Feature(2)order(449..454,467..469,620..622,626..628,650..652)
Misc Feature(3)773..775
Misc Feature(4)806..817
Exon (1)1..304
Gene:PPIB
Gene Synonym:CYP-S1; CYPB; HEL-S-39; OI9; SCYLP
Exon (2)305..418
Gene:PPIB
Gene Synonym:CYP-S1; CYPB; HEL-S-39; OI9; SCYLP
Exon (3)419..512
Gene:PPIB
Gene Synonym:CYP-S1; CYPB; HEL-S-39; OI9; SCYLP
Exon (4)513..697
Gene:PPIB
Gene Synonym:CYP-S1; CYPB; HEL-S-39; OI9; SCYLP
Exon (5)698..1028
Gene:PPIB
Gene Synonym:CYP-S1; CYPB; HEL-S-39; OI9; SCYLP
Translation MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(35..36)-dbSNP:
complement(35..36)-, gcdbSNP:34392166
complement(76)-g, cdbSNP:369957382
complement(78)-g, cdbSNP:376643972
complement(90)-c, adbSNP:191528507
complement(92)-g, cdbSNP:372547970
complement(150)-t, cdbSNP:188404221
complement(160)-t, gdbSNP:375998912
complement(161)-g, cdbSNP:367616150
complement(170)-t, cdbSNP:201472818
complement(178)-g, adbSNP:141504929
complement(193)-g, adbSNP:148644836
195+g, tdbSNP:137853864
complement(212)-t, cdbSNP:367853445
complement(254)-t, cdbSNP:200307684
289+, cdbSNP:137853865
complement(293)-t, cdbSNP:137883097
complement(308)-dbSNP:
complement(308)-g, adbSNP:373715158
complement(347)-t, gdbSNP:386519298
347+g, tdbSNP:11558595
complement(367)-t, gdbSNP:370565028
complement(393)-t, cdbSNP:202087362
complement(403)-g, adbSNP:370932084
complement(410)-t, cdbSNP:200786931
complement(440)-dbSNP:
complement(440)-t, cdbSNP:368454186
complement(444)-t, cdbSNP:112988616
482+a, gdbSNP:137853866
complement(493)-t, cdbSNP:386564595
503+a, gdbSNP:11558596
complement(507)-g, adbSNP:199971446
complement(526)-dbSNP:
complement(526)-g, adbSNP:138741187
541+c, tdbSNP:11558597
complement(568)-g, adbSNP:373618000
583..592+, gagcatggccdbSNP:137853868
complement(585)-c, adbSNP:150146348
620+c, tdbSNP:121434559
complement(634)-t, cdbSNP:369334476
complement(635)-t, cdbSNP:140817860
complement(657)-t, cdbSNP:200990246
661+c, gdbSNP:28720193
complement(662)-t, cdbSNP:201926681
complement(678)-t, cdbSNP:199606428
complement(688)-t, cdbSNP:151284742
complement(717)-dbSNP:
complement(717)-t, gdbSNP:369952028
725..728+, aagadbSNP:137853869
732..735+, acagdbSNP:398122834
complement(738)-t, cdbSNP:200864554
complement(766)-g, adbSNP:369889089
complement(775)-g, adbSNP:143287832
789+c, tdbSNP:1804427
complement(797)-g, adbSNP:200904948
complement(821)-g, cdbSNP:142381852
complement(834)-t, gdbSNP:201974607
841+a, tdbSNP:2307248
complement(854)-t, cdbSNP:367916633
complement(871)-g, adbSNP:373762582
complement(872)-t, cdbSNP:201075610
883+c, tdbSNP:9091
885+c, gdbSNP:2230223
899+c, tdbSNP:1804426
complement(901)-t, cdbSNP:202116920
complement(912)-g, adbSNP:1043001
925+a, cdbSNP:1803362
complement(928)-t, gdbSNP:1043016
complement(965)-, adbSNP:34628002
complement(985)-t, gdbSNP:1043082
complement(1003..1004)-, tdbSNP:376202696
complement(1007)-c, adbSNP:62024249
complement(1009..1010)-, adbSNP:397748288
complement(1010)-t, adbSNP:113626158
complement(1022..1023)-, adbSNP:5813282
complement(1024..1025)-, tdbSNP:202080377
Gene SymbolPPIB
Gene SynonymCYP-S1; CYPB; HEL-S-39; OI9; SCYLP
Chromosome15
Locus Map15q21-q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000942 Homo sapiens peptidylprolyl isomerase B (cyclophilin B) (PPIB), mRNA. In-stock $99.00 5-7
Title Cyclophilin B supports Myc and mutant p53-dependent survival of glioblastoma multiforme cells .
Author Choi JW, Schroeder MA, Sarkaria JN and Bram RJ.
Journal Cancer Res. 74 (2), 484-496 (2014)
Title An additional function of the rough endoplasmic reticulum protein complex prolyl 3-hydroxylase 1.cartilage-associated protein.cyclophilin B: the CXXXC motif reveals disulfide isomerase activity in vitro .
Author Ishikawa Y and Bachinger HP.
Journal J. Biol. Chem. 288 (44), 31437-31446 (2013)
Title Cyclosporin A impairs the secretion and activity of ADAMTS13 (a disintegrin and metalloprotease with thrombospondin type 1 repeat) .
Author Hershko K, Simhadri VL, Blaisdell A, Hunt RC, Newell J, Tseng SC, Hershko AY, Choi JW, Sauna ZE, Wu A, Bram RJ, Komar AA and Kimchi-Sarfaty C.
Journal J. Biol. Chem. 287 (53), 44361-44371 (2012)
Title Cyclophilin B attenuates the expression of TNF-alpha in lipopolysaccharide-stimulated macrophages through the induction of .
Author Marcant A, Denys A, Melchior A, Martinez P, Deligny A, Carpentier M and Allain F.
Journal J. Immunol. 189 (4), 2023-2032 (2012)
Title Release of overexpressed CypB activates ERK signaling through CD147 binding for hepatoma cell resistance to oxidative stress .
Author Kim K, Kim H, Jeong K, Jung MH, Hahn BS, Yoon KS, Jin BK, Jahng GH, Kang I, Ha J and Choe W.
Journal Apoptosis 17 (8), 784-796 (2012)
Title Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes .
Author Rasmussen HH, van Damme J, Puype M, Gesser B, Celis JE and Vandekerckhove J.
Journal Electrophoresis 13 (12), 960-969 (1992)
Title s-cyclophilin is retained intracellularly via a unique COOH-terminal sequence and colocalizes with the calcium storage protein calreticulin .
Author Arber S, Krause KH and Caroni P.
Journal J. Cell Biol. 116 (1), 113-125 (1992)
Title Somatic cell mapping of the human cyclophilin B gene (PPIB) to chromosome 15 .
Author Peddada LB, McPherson JD, Law R, Wasmuth JJ, Youderian P and Deans RJ.
Journal Cytogenet. Cell Genet. 60 (3-4), 219-221 (1992)
Title An endoplasmic reticulum-specific cyclophilin .
Author Hasel KW, Glass JR, Godbout M and Sutcliffe JG.
Journal Mol. Cell. Biol. 11 (7), 3484-3491 (1991)
Title Human cyclophilin B: a second cyclophilin gene encodes a peptidyl-prolyl isomerase with a signal sequence .
Author Price ER, Zydowsky LD, Jin MJ, Baker CH, McKeon FD and Walsh CT.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (5), 1903-1907 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.