Homo sapiens peptidylprolyl isomerase B (cyclophilin B) (PPIB), mRNA.
| RefSeq Version | NM_000942.4, 44890060 |
| Length | 1045 bp |
| Structure | linear |
| Update Date | 01-MAY-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens peptidylprolyl isomerase B (cyclophilin B) (PPIB), mRNA. |
| Product | peptidyl-prolyl cis-trans isomerase B precursor |
| Comment | Summary: The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Variants have been identified in this protein that give rise to recessive forms of osteogenesis imperfecta. [provided by RefSeq]. |
| RefSeq | NP_000933.1 |
| CDS | 170..820 | Exon (1) | 1..304 | Exon (2) | 1..304 | Exon (3) | 305..418 | Exon (4) | 419..512 | Exon (5) | 513..697 | Exon (6) | 698..1028 |
| Translation | MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(35) | - | , gc | dbSNP:34392166 |
| complement(91..92) | - | , cg | dbSNP:36089994 |
| 195 | + | g, t | dbSNP:137853864 |
| 232 | + | a, c | dbSNP:4904 |
| 289 | + | , c | dbSNP:137853865 |
| 347 | + | g, t | dbSNP:11558595 |
| complement(444) | - | t, c | dbSNP:112988616 |
| 482 | + | a, g | dbSNP:137853866 |
| 493 | + | c, t | dbSNP:2307247 |
| 541 | + | c, t | dbSNP:11558597 |
| 583..592 | + | , gagcatggcc | dbSNP:137853868 |
| 620 | + | c, t | dbSNP:121434559 |
| 661 | + | c, g | dbSNP:28720193 |
| complement(697) | - | , largedeletion | dbSNP:71849239 |
| 725..728 | + | , aaga | dbSNP:137853869 |
| 789 | + | c, t | dbSNP:1804427 |
| 841 | + | a, t | dbSNP:2307248 |
| 883 | + | c, t | dbSNP:9091 |
| 885 | + | c, g | dbSNP:2230223 |
| 899 | + | c, t | dbSNP:1804426 |
| complement(912) | - | g, a | dbSNP:1043001 |
| 925 | + | a, c | dbSNP:1803362 |
| complement(928) | - | t, g | dbSNP:1043016 |
| complement(965) | - | , a | dbSNP:34628002 |
| complement(985) | - | t, g | dbSNP:1043082 |
| complement(1007) | - | c, a | dbSNP:62024249 |
| complement(1008..1009) | - | , a | dbSNP:67080938 |
| complement(1009..1010) | - | , a | dbSNP:11449965 |
| complement(1010..1011) | - | , a | dbSNP:33951681 |
| complement(1010) | - | t, a | dbSNP:113626158 |
| complement(1011..1012) | - | , a | dbSNP:5813283 |
| complement(1012..1013) | - | , a | dbSNP:35436904 |
| complement(1013..1014) | - | , a | dbSNP:5813282 |
| complement(1014..1015) | - | , a | dbSNP:11395387 |
| complement(1021..1022) | - | , a | dbSNP:67185132 |
| complement(1022..1023) | - | , a | dbSNP:36034101 |
| complement(1022) | - | t, a | dbSNP:116930575 |
| Gene Symbol | PPIB |
| Gene Synonym | CYP-S1; CYPB; MGC14109; MGC2224; OI9; SCYLP |
| Chromosome | 15 |
| Locus Map | 15q21-q22 |
| All Transcripts | NM_000942 |
| Title | Structural basis of cyclophilin B binding by the calnexin/calreticulin P-domain . |
| Author | Kozlov,G., Bastos-Aristizabal,S., Maattanen,P., Rosenauer,A., Zheng,F., Killikelly,A., Trempe,J.F., Thomas,D.Y. and Gehring,K. |
| Journal | J. Biol. Chem. 285 (46), 35551-35557 (2010) |
| Title | Cyclophilin B as a co-regulator of prolactin-induced gene expression and function in breast cancer cells . |
| Author | Fang,F., Zheng,J., Galbaugh,T.L., Fiorillo,A.A., Hjort,E.E., Zeng,X. and Clevenger,C.V. |
| Journal | J. Mol. Endocrinol. 44 (6), 319-329 (2010) |
| Title | Lack of cyclophilin B in osteogenesis imperfecta with normal collagen folding . |
| Author | Barnes,A.M., Carter,E.M., Cabral,W.A., Weis,M., Chang,W., Makareeva,E., Leikin,S., Rotimi,C.N., Eyre,D.R., Raggio,C.L. and Marini,J.C. |
| Journal | N. Engl. J. Med. 362 (6), 521-528 (2010) |
| Title | Synthesis of heparan sulfate with cyclophilin B-binding properties is determined by cell type-specific expression of sulfotransferases . |
| Author | Deligny,A., Denys,A., Marcant,A., Melchior,A., Mazurier,J., van Kuppevelt,T.H. and Allain,F. |
| Journal | J. Biol. Chem. 285 (3), 1701-1715 (2010) |
| Title | Cyclophilin B interacts with sodium-potassium ATPase and is required for pump activity in proximal tubule cells of the kidney . |
| Author | Sune,G., Sarro,E., Puigmule,M., Lopez-Hellin,J., Zufferey,M., Pertel,T., Luban,J. and Meseguer,A. |
| Journal | PLoS ONE 5 (11), E13930 (2010) |
| Title | Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes . |
| Author | Rasmussen,H.H., van Damme,J., Puype,M., Gesser,B., Celis,J.E. and Vandekerckhove,J. |
| Journal | Electrophoresis 13 (12), 960-969 (1992) |
| Title | s-cyclophilin is retained intracellularly via a unique COOH-terminal sequence and colocalizes with the calcium storage protein calreticulin . |
| Author | Arber,S., Krause,K.H. and Caroni,P. |
| Journal | J. Cell Biol. 116 (1), 113-125 (1992) |
| Title | Somatic cell mapping of the human cyclophilin B gene (PPIB) to chromosome 15 . |
| Author | Peddada,L.B., McPherson,J.D., Law,R., Wasmuth,J.J., Youderian,P. and Deans,R.J. |
| Journal | Cytogenet. Cell Genet. 60 (3-4), 219-221 (1992) |
| Title | An endoplasmic reticulum-specific cyclophilin . |
| Author | Hasel,K.W., Glass,J.R., Godbout,M. and Sutcliffe,J.G. |
| Journal | Mol. Cell. Biol. 11 (7), 3484-3491 (1991) |
| Title | Human cyclophilin B: a second cyclophilin gene encodes a peptidyl-prolyl isomerase with a signal sequence . |
| Author | Price,E.R., Zydowsky,L.D., Jin,M.J., Baker,C.H., McKeon,F.D. and Walsh,C.T. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 88 (5), 1903-1907 (1991) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |