• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens peptidylprolyl isomerase B (cyclophilin B) (PPIB), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000942 Homo sapiens peptidylprolyl isomerase B (cyclophilin B) (PPIB), mRNA. GenEZ ORF Cloning In-stock $308.00 $259.00 10

*Business Day

Related Services

RefSeq Version NM_000942.4, 44890060
Length 1045 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens peptidylprolyl isomerase B (cyclophilin B) (PPIB), mRNA.
Product peptidyl-prolyl cis-trans isomerase B precursor
Comment

Summary: The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Variants have been identified in this protein that give rise to recessive forms of osteogenesis imperfecta. [provided by RefSeq, Oct 2009].

RefSeq NP_000933.1
CDS 170..820
Misc Feature(1)302..778
Misc Feature(2)341..766
Misc Feature(3)order(449..454,467..469,620..622,626..628,650..652)
Misc Feature(4)773..775
Misc Feature(5)806..817
Exon (1)1..304
Gene:PPIB
Gene Synonym:CYP-S1; CYPB; OI9; SCYLP
Exon (2)305..418
Gene:PPIB
Gene Synonym:CYP-S1; CYPB; OI9; SCYLP
Exon (3)419..512
Gene:PPIB
Gene Synonym:CYP-S1; CYPB; OI9; SCYLP
Exon (4)513..697
Gene:PPIB
Gene Synonym:CYP-S1; CYPB; OI9; SCYLP
Exon (5)698..1028
Gene:PPIB
Gene Synonym:CYP-S1; CYPB; OI9; SCYLP
Translation MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(35)-dbSNP:
complement(35)-, gcdbSNP:34392166
complement(90)-c, adbSNP:191528507
complement(91..92)-, cgdbSNP:36089994
complement(150)-t, cdbSNP:188404221
complement(170)-t, cdbSNP:201472818
complement(178)-g, adbSNP:141504929
complement(193)-g, adbSNP:148644836
195+g, tdbSNP:137853864
complement(201)-g, adbSNP:143945038
complement(232)-c, adbSNP:4904
complement(254)-t, cdbSNP:200307684
complement(289)-, cdbSNP:137853865
complement(293)-t, cdbSNP:137883097
complement(347)-dbSNP:
complement(347)-t, gdbSNP:11558595
complement(393)-t, cdbSNP:202087362
complement(410)-t, cdbSNP:200786931
complement(444)-dbSNP:
complement(444)-t, cdbSNP:112988616
complement(482)-g, adbSNP:137853866
complement(493)-t, cdbSNP:2307247
complement(503)-g, adbSNP:11558596
complement(507)-g, adbSNP:199971446
complement(526)-dbSNP:
complement(526)-g, adbSNP:138741187
complement(541)-t, cdbSNP:11558597
complement(583..592)-, gagcatggccdbSNP:137853868
complement(585)-c, adbSNP:150146348
complement(620)-t, cdbSNP:121434559
complement(635)-t, cdbSNP:140817860
complement(657)-t, cdbSNP:200990246
complement(661)-g, cdbSNP:28720193
complement(662)-t, cdbSNP:201926681
complement(678)-t, cdbSNP:199606428
complement(688)-t, cdbSNP:151284742
complement(725..728)-dbSNP:
complement(725..728)-, aagadbSNP:137853869
complement(738)-t, cdbSNP:200864554
complement(775)-g, adbSNP:143287832
complement(789)-t, cdbSNP:1804427
complement(797)-g, adbSNP:200904948
complement(821)-g, cdbSNP:142381852
complement(834)-t, gdbSNP:201974607
complement(841)-t, adbSNP:2307248
complement(872)-t, cdbSNP:201075610
complement(883)-t, cdbSNP:9091
complement(885)-g, cdbSNP:2230223
complement(899)-t, cdbSNP:1804426
complement(901)-t, cdbSNP:202116920
complement(912)-g, adbSNP:1043001
complement(925)-c, adbSNP:1803362
complement(928)-t, gdbSNP:1043016
complement(965)-, adbSNP:34628002
complement(985)-t, gdbSNP:1043082
complement(1007)-c, adbSNP:62024249
complement(1010)-t, adbSNP:113626158
complement(1021..1022)-, adbSNP:5813282
complement(1022..1023)-, adbSNP:36034101
complement(1024..1025)-, tdbSNP:202080377
Gene SymbolPPIB
Gene SynonymCYP-S1; CYPB; OI9; SCYLP
Chromosome15
Locus Map15q21-q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000942 Homo sapiens peptidylprolyl isomerase B (cyclophilin B) (PPIB), mRNA. In-stock $308.00 $259.00 10
Title Cyclosporin A impairs the secretion and activity of ADAMTS13 (a disintegrin and metalloprotease with thrombospondin type 1 repeat) .
Author Hershko,K., Simhadri,V.L., Blaisdell,A., Hunt,R.C., Newell,J., Tseng,S.C., Hershko,A.Y., Choi,J.W., Sauna,Z.E., Wu,A., Bram,R.J., Komar,A.A. and Kimchi-Sarfaty,C.
Journal J. Biol. Chem. 287 (53), 44361-44371 (2012)
Title Cyclophilin B attenuates the expression of TNF-alpha in lipopolysaccharide-stimulated macrophages through the induction of .
Author Marcant,A., Denys,A., Melchior,A., Martinez,P., Deligny,A., Carpentier,M. and Allain,F.
Journal J. Immunol. 189 (4), 2023-2032 (2012)
Title Release of overexpressed CypB activates ERK signaling through CD147 binding for hepatoma cell resistance to oxidative stress .
Author Kim,K., Kim,H., Jeong,K., Jung,M.H., Hahn,B.S., Yoon,K.S., Jin,B.K., Jahng,G.H., Kang,I., Ha,J. and Choe,W.
Journal Apoptosis 17 (8), 784-796 (2012)
Title Spatiotemporal behavior of nuclear cyclophilin B indicates a role in RNA transcription .
Author Dieriks,B. and Van Oostveldt,P.
Journal Int. J. Mol. Med. 29 (6), 1031-1038 (2012)
Title Comparing human pancreatic cell secretomes by in vitro aptamer selection identifies cyclophilin B as a candidate pancreatic cancer biomarker .
Author Ray,P., Rialon-Guevara,K.L., Veras,E., Sullenger,B.A. and White,R.R.
Journal J. Clin. Invest. 122 (5), 1734-1741 (2012)
Title Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes .
Author Rasmussen,H.H., van Damme,J., Puype,M., Gesser,B., Celis,J.E. and Vandekerckhove,J.
Journal Electrophoresis 13 (12), 960-969 (1992)
Title s-cyclophilin is retained intracellularly via a unique COOH-terminal sequence and colocalizes with the calcium storage protein calreticulin .
Author Arber,S., Krause,K.H. and Caroni,P.
Journal J. Cell Biol. 116 (1), 113-125 (1992)
Title Somatic cell mapping of the human cyclophilin B gene (PPIB) to chromosome 15 .
Author Peddada,L.B., McPherson,J.D., Law,R., Wasmuth,J.J., Youderian,P. and Deans,R.J.
Journal Cytogenet. Cell Genet. 60 (3-4), 219-221 (1992)
Title An endoplasmic reticulum-specific cyclophilin .
Author Hasel,K.W., Glass,J.R., Godbout,M. and Sutcliffe,J.G.
Journal Mol. Cell. Biol. 11 (7), 3484-3491 (1991)
Title Human cyclophilin B: a second cyclophilin gene encodes a peptidyl-prolyl isomerase with a signal sequence .
Author Price,E.R., Zydowsky,L.D., Jin,M.J., Baker,C.H., McKeon,F.D. and Walsh,C.T.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (5), 1903-1907 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.