• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) (PTGS2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27989 Homo sapiens prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) (PTGS2), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu27989C Homo sapiens prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) (PTGS2), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000963.3, 574956975
Length 1815 bp
Structure linear
Update Date 13-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) (PTGS2), mRNA.
Product prostaglandin G/H synthase 2 precursor
Comment

Summary: Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes the inducible isozyme. It is regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis. [provided by RefSeq, Feb 2009].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000954.1
CDS 138..1952
Misc Feature(1)192..299
Misc Feature(2)order(195..197,237..239)
Misc Feature(3)360..1823
Misc Feature(4)order(444..446,708..710,1128..1130,1137..1142,1152..1154,
Misc Feature(5)order(468..470,474..482,501..515,519..521,780..782,
Misc Feature(6)501..1817
Misc Feature(7)order(537..539,690..692,702..704,714..716,723..731,
Misc Feature(8)1683..1685
Exon (1)1..189
Gene:PTGS2
Gene Synonym:COX-2; COX2; GRIPGHS; hCox-2; PGG/HS; PGHS-2; PHS-2
Exon (2)190..306
Gene:PTGS2
Gene Synonym:COX-2; COX2; GRIPGHS; hCox-2; PGG/HS; PGHS-2; PHS-2
Exon (3)307..450
Gene:PTGS2
Gene Synonym:COX-2; COX2; GRIPGHS; hCox-2; PGG/HS; PGHS-2; PHS-2
Exon (4)451..594
Gene:PTGS2
Gene Synonym:COX-2; COX2; GRIPGHS; hCox-2; PGG/HS; PGHS-2; PHS-2
Exon (5)595..776
Gene:PTGS2
Gene Synonym:COX-2; COX2; GRIPGHS; hCox-2; PGG/HS; PGHS-2; PHS-2
Exon (6)777..860
Gene:PTGS2
Gene Synonym:COX-2; COX2; GRIPGHS; hCox-2; PGG/HS; PGHS-2; PHS-2
Exon (7)861..1107
Gene:PTGS2
Gene Synonym:COX-2; COX2; GRIPGHS; hCox-2; PGG/HS; PGHS-2; PHS-2
Exon (8)1108..1394
Gene:PTGS2
Gene Synonym:COX-2; COX2; GRIPGHS; hCox-2; PGG/HS; PGHS-2; PHS-2
Exon (9)1395..1542
Gene:PTGS2
Gene Synonym:COX-2; COX2; GRIPGHS; hCox-2; PGG/HS; PGHS-2; PHS-2
Exon (10)1543..4493
Gene:PTGS2
Gene Synonym:COX-2; COX2; GRIPGHS; hCox-2; PGG/HS; PGHS-2; PHS-2
Translation MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER STEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(13)-dbSNP:
complement(13)-t, gdbSNP:5271
complement(13)-t, gdbSNP:386438755
complement(20)-t, adbSNP:4648257
complement(41)-t, cdbSNP:200536996
complement(58)-g, adbSNP:199630699
complement(64)-g, cdbSNP:201480185
complement(67)-g, adbSNP:200564627
complement(75)-t, cdbSNP:386519398
75+c, tdbSNP:11567819
complement(86)-g, cdbSNP:201481563
complement(87)-t, cdbSNP:200278253
complement(89)-g, adbSNP:201843465
complement(98)-t, cdbSNP:201014475
complement(111)-g, cdbSNP:200209794
complement(112..113)-, gdbSNP:34888870
complement(119)-t, gdbSNP:183937640
135..136+c, gdbSNP:3134592
135+a, c, gdbSNP:3134591
140+a, gdbSNP:20426
complement(147)-g, cdbSNP:200140544
complement(167)-c, adbSNP:201912060
complement(174)-c, adbSNP:200906212
complement(186)-t, cdbSNP:199946406
complement(205)-dbSNP:
complement(205)-t, gdbSNP:199737603
complement(232)-t, cdbSNP:201588411
complement(263)-g, adbSNP:200215667
complement(269)-g, adbSNP:373824545
complement(273)-g, adbSNP:199661060
complement(281)-t, adbSNP:368723361
complement(306)-g, adbSNP:373745396
complement(324)-dbSNP:
complement(324)-t, g, cdbSNP:189809394
complement(408)-t, gdbSNP:199619767
complement(411)-t, gdbSNP:201046652
complement(421)-t, cdbSNP:200132172
complement(424)-t, cdbSNP:145215600
complement(425)-g, adbSNP:201906674
complement(440)-g, adbSNP:147896616
443+c, gdbSNP:5277
complement(481)-dbSNP:
complement(481)-g, adbSNP:377655174
complement(503)-t, g, adbSNP:200314986
complement(509)-g, adbSNP:202013754
complement(527)-t, cdbSNP:20429
complement(533)-t, cdbSNP:4648264
complement(539)-g, adbSNP:201938310
complement(548)-t, gdbSNP:200911813
complement(557)-g, adbSNP:199972508
complement(569)-t, cdbSNP:4648265
complement(575)-t, cdbSNP:201238353
complement(599)-dbSNP:
complement(599)-t, cdbSNP:142741435
complement(615)-c, adbSNP:200842448
complement(651)-t, cdbSNP:199513587
complement(674)-g, adbSNP:148479703
complement(695)-t, gdbSNP:201493026
complement(713)-t, cdbSNP:200316914
complement(734)-g, adbSNP:199735403
complement(737)-t, adbSNP:372267158
complement(742)-t, cdbSNP:141500962
complement(761)-g, adbSNP:200311544
complement(764)-t, cdbSNP:201592586
complement(773)-g, adbSNP:140664948
complement(797)-dbSNP:
complement(797)-g, adbSNP:200000802
complement(820)-g, adbSNP:3218622
complement(869)-dbSNP:
complement(869)-g, adbSNP:201616417
complement(878)-t, cdbSNP:186230736
complement(895)-t, cdbSNP:369291855
complement(917)-g, adbSNP:199504824
complement(920)-g, adbSNP:201377871
complement(932)-g, adbSNP:113771132
complement(945)-g, adbSNP:201723686
complement(947)-c, adbSNP:200279549
complement(953)-g, adbSNP:150242385
complement(956)-t, cdbSNP:372801628
complement(1013)-t, cdbSNP:201837693
complement(1015)-t, cdbSNP:148160346
complement(1034)-g, adbSNP:201011990
complement(1035)-t, cdbSNP:200204426
complement(1037)-t, cdbSNP:5278
complement(1066)-t, cdbSNP:201228846
complement(1077)-g, adbSNP:200101876
complement(1097)-t, cdbSNP:202086424
complement(1112)-dbSNP:
complement(1112)-t, cdbSNP:201006741
complement(1120)-t, cdbSNP:199520386
complement(1142)-g, adbSNP:3218623
complement(1147)-t, cdbSNP:200843740
complement(1149)-g, adbSNP:199709318
complement(1159)-t, cdbSNP:371762608
complement(1163)-t, gdbSNP:201764120
complement(1219)-t, cdbSNP:200479241
complement(1235)-t, cdbSNP:147906320
complement(1305)-g, adbSNP:201708424
complement(1333)-g, adbSNP:367650109
1337+a, gdbSNP:3218624
complement(1346)-t, cdbSNP:5279
complement(1361)-c, adbSNP:202093833
complement(1387)-g, adbSNP:201373237
1419+dbSNP:
1419+c, g, tdbSNP:4648279
complement(1422)-t, cdbSNP:202020013
complement(1443)-c, adbSNP:139215497
complement(1454)-g, adbSNP:200089522
complement(1481)-g, adbSNP:146262134
complement(1484)-g, adbSNP:200652624
complement(1511)-t, cdbSNP:200025327
complement(1520)-g, adbSNP:61757788
complement(1548)-dbSNP:
complement(1548)-t, cdbSNP:139787656
complement(1569)-t, cdbSNP:141702884
complement(1581)-t, cdbSNP:267598241
complement(1584)-t, cdbSNP:189679860
complement(1600)-g, adbSNP:5272
complement(1600)-g, adbSNP:386598159
complement(1632)-g, adbSNP:201405348
complement(1633)-c, adbSNP:200408009
complement(1634)-g, adbSNP:4648288
complement(1650)-t, cdbSNP:200926368
complement(1667)-t, adbSNP:200030471
complement(1669)-t, cdbSNP:5273
complement(1707)-t, cdbSNP:201342852
complement(1710)-t, adbSNP:199820825
complement(1723)-g, adbSNP:201922079
complement(1769)-g, adbSNP:139087930
complement(1771)-g, adbSNP:200583134
complement(1808)-g, adbSNP:200081470
complement(1818)-t, adbSNP:201730487
complement(1836)-t, cdbSNP:201606460
complement(1869)-t, gdbSNP:200492220
complement(1892)-c, adbSNP:5274
complement(1894)-t, gdbSNP:201772944
complement(1896)-t, cdbSNP:386581154
complement(1896)-g, adbSNP:3218625
complement(1904)-g, adbSNP:148865858
complement(1905)-t, cdbSNP:373482960
complement(1907)-g, adbSNP:199504402
complement(1936)-t, cdbSNP:201299558
complement(1940)-c, adbSNP:200312294
complement(1982)-t, cdbSNP:199738725
complement(2009)-g, adbSNP:201534244
complement(2037)-t, cdbSNP:200232733
complement(2059)-t, adbSNP:202188713
2073+c, tdbSNP:4648289
complement(2073)-g, adbSNP:386594397
complement(2079)-g, adbSNP:200536698
complement(2080)-t, c, adbSNP:201923275
complement(2136)-g, cdbSNP:200786963
complement(2150)-c, adbSNP:200002596
complement(2162)-c, adbSNP:139462473
complement(2199)-t, g, cdbSNP:4648290
complement(2214)-t, cdbSNP:199817349
complement(2224..2228)-, tataadbSNP:61352290
2228..2232+, attatdbSNP:4648291
complement(2229..2233)-, tataadbSNP:36233646
2270+a, gdbSNP:1051896
complement(2319)-t, cdbSNP:201916655
complement(2321)-t, cdbSNP:142234315
complement(2331)-c, adbSNP:199740331
complement(2351)-t, cdbSNP:201917851
2379+c, tdbSNP:5275
complement(2385)-c, adbSNP:199629276
2402+a, gdbSNP:13306031
complement(2441)-t, cdbSNP:201419014
complement(2450)-g, adbSNP:5276
complement(2451)-g, adbSNP:199506254
complement(2459)-t, adbSNP:201484578
complement(2487)-g, adbSNP:200416386
complement(2533)-t, g, adbSNP:201842290
2546+a, gdbSNP:138908498
complement(2548)-g, adbSNP:201014322
complement(2554)-t, adbSNP:200207384
complement(2570)-g, adbSNP:201745115
complement(2579)-t, cdbSNP:201083629
complement(2581)-t, g, cdbSNP:4648292
2614..2615+a, tdbSNP:3134589
complement(2630)-g, adbSNP:4648293
complement(2665)-c, adbSNP:201104814
complement(2693)-t, adbSNP:115973952
complement(2713)-g, adbSNP:201782015
2749+a, gdbSNP:4648294
complement(2761)-g, adbSNP:200795899
2767+c, tdbSNP:1051897
complement(2811)-g, adbSNP:199858950
complement(2814)-t, gdbSNP:201688357
complement(2821)-g, adbSNP:200717726
complement(2822)-t, cdbSNP:199740165
complement(2831)-t, gdbSNP:201588251
complement(2833)-t, cdbSNP:193144472
complement(2844)-t, cdbSNP:199657133
complement(2871)-g, cdbSNP:201157576
complement(2878)-c, adbSNP:200351050
complement(2882)-t, adbSNP:201923503
complement(2890)-t, adbSNP:201467945
complement(2892)-t, c, adbSNP:200400596
complement(2928)-g, adbSNP:202215792
complement(3008)-g, adbSNP:2206593
3028+c, tdbSNP:2853804
complement(3028)-g, adbSNP:386575362
complement(3036)-t, cdbSNP:199859157
complement(3048)-t, adbSNP:150239498
complement(3052)-g, cdbSNP:202024704
complement(3091)-t, cdbSNP:201042127
3106+a, gdbSNP:4648295
complement(3106)-g, adbSNP:386594398
complement(3122)-g, adbSNP:200089422
complement(3155)-g, adbSNP:201908600
complement(3162)-t, adbSNP:200729681
complement(3190)-t, cdbSNP:199966067
complement(3197)-c, adbSNP:202003593
complement(3198)-g, adbSNP:200679193
complement(3254)-g, adbSNP:190150368
complement(3255)-t, cdbSNP:184845240
complement(3264)-t, adbSNP:200577098
complement(3287)-t, adbSNP:11567829
complement(3301)-g, cdbSNP:201576572
complement(3303)-g, adbSNP:200295049
complement(3319)-t, adbSNP:202004599
complement(3326)-t, cdbSNP:201595920
complement(3341)-t, gdbSNP:200409468
complement(3369)-t, cdbSNP:4648296
complement(3378)-g, adbSNP:4648297
complement(3396)-t, cdbSNP:199947679
complement(3403)-t, cdbSNP:202217156
complement(3434)-t, cdbSNP:201238205
complement(3437)-t, adbSNP:368833559
3457+g, tdbSNP:13306032
complement(3457)-c, adbSNP:386527983
complement(3518)-t, gdbSNP:187958342
3535+c, tdbSNP:13306033
complement(3548)-g, adbSNP:183653397
complement(3550)-t, cdbSNP:182127940
complement(3560)-g, adbSNP:200069207
complement(3573)-t, adbSNP:201601925
complement(3580)-g, adbSNP:200482826
complement(3582)-g, adbSNP:199602058
3590+c, tdbSNP:13306035
complement(3597)-t, gdbSNP:192334329
complement(3612)-t, gdbSNP:200828213
complement(3623)-t, adbSNP:199505687
complement(3634)-t, gdbSNP:201377863
complement(3643)-t, gdbSNP:200312413
complement(3646)-t, cdbSNP:199736988
complement(3693)-g, adbSNP:201532679
complement(3698)-t, cdbSNP:200177856
complement(3710)-t, adbSNP:202009206
complement(3714)-t, cdbSNP:201231127
complement(3729)-g, cdbSNP:200492640
complement(3747)-t, cdbSNP:202243625
complement(3748)-g, cdbSNP:200779240
3755+a, gdbSNP:4648298
complement(3768)-g, adbSNP:201526173
complement(3780..3781)-, adbSNP:397804274
complement(3789..3790)-, adbSNP:11384450
complement(3790)-c, adbSNP:200986059
complement(3808)-t, g, adbSNP:199850911
3808+, tdbSNP:3835508
3811+c, tdbSNP:2853805
3828+a, cdbSNP:11567830
complement(3828)-c, adbSNP:386519400
complement(3839)-t, cdbSNP:200845455
3845+a, cdbSNP:3179567
complement(3860)-t, gdbSNP:4648299
complement(3901)-g, adbSNP:201917612
complement(3910)-c, adbSNP:200531158
complement(3996)-t, cdbSNP:199626279
complement(4005)-t, gdbSNP:201415472
complement(4026)-g, adbSNP:4648300
complement(4029)-t, gdbSNP:199834448
complement(4039)-g, adbSNP:201360946
complement(4041)-g, c, adbSNP:188254107
complement(4042)-t, cdbSNP:202089327
complement(4061)-t, cdbSNP:201006478
complement(4079)-t, cdbSNP:4648301
complement(4081)-g, cdbSNP:201730694
complement(4092)-g, adbSNP:200883517
complement(4096)-c, adbSNP:200097577
complement(4119)-g, adbSNP:183201650
complement(4120)-t, cdbSNP:200985751
complement(4121)-g, adbSNP:200027430
complement(4164)-t, gdbSNP:689467
4172+a, gdbSNP:689468
complement(4172)-t, cdbSNP:386605799
complement(4185)-t, gdbSNP:199854202
complement(4198)-t, adbSNP:369883147
complement(4206)-t, adbSNP:201684522
4219+g, tdbSNP:4648302
complement(4239)-t, cdbSNP:4648303
4240+a, gdbSNP:689469
complement(4278)-g, adbSNP:200642986
complement(4280)-t, gdbSNP:191788711
complement(4306)-t, adbSNP:201156755
4310+a, tdbSNP:13306038
complement(4311)-, tdbSNP:57974311
complement(4311)-t, adbSNP:201931599
complement(4317)-t, adbSNP:201061872
complement(4319..4320)-, tdbSNP:149091810
complement(4320)-, tdbSNP:371722469
complement(4320)-t, gdbSNP:200428982
complement(4321)-t, g, adbSNP:202092932
complement(4331)-g, adbSNP:201348126
complement(4333)-g, adbSNP:185983564
complement(4369)-t, cdbSNP:199824454
4379+a, c, tdbSNP:689470
complement(4379)-t, cdbSNP:386605800
complement(4398)-g, cdbSNP:201039864
complement(4418)-t, adbSNP:200076979
complement(4420)-t, cdbSNP:372262132
complement(4485)-g, adbSNP:201913348
Gene SymbolPTGS2
Gene SynonymCOX-2; COX2; GRIPGHS; hCox-2; PGG/HS; PGHS-2; PHS-2
Chromosome1
Locus Map1q25.2-q25.3
Title A prospective study of macrophage inhibitory cytokine-1 (MIC-1/GDF15) and risk of colorectal cancer .
Author Mehta RS, Song M, Bezawada N, Wu K, Garcia-Albeniz X, Morikawa T, Fuchs CS, Ogino S, Giovannucci EL and Chan AT.
Journal J. Natl. Cancer Inst. 106 (4), DJU016 (2014)
Title NF-kappaB and COX-2 expression in nonmalignant endometrial lesions and cancer .
Author Faloppa CC, Baiocchi G, Cunha IW, Fregnani JH, Osorio CA, Fukazawa EM, Kumagai LY, Badiglian-Filho L, Pinto GL and Soares FA.
Journal Am. J. Clin. Pathol. 141 (2), 196-203 (2014)
Title Altered expression of inflammation-associated genes in oviductal cells following follicular fluid exposure: implications for ovarian carcinogenesis .
Author Lau A, Kollara A, St John E, Tone AA, Virtanen C, Greenblatt EM, King WA and Brown TJ.
Journal Exp. Biol. Med. (Maywood) 239 (1), 24-32 (2014)
Title Expression and significance of cyclooxygenase-2 mRNA in benign and malignant ascites .
Author Lu J, Li XF, Kong LX, Ma L, Liao SH and Jiang CY.
Journal World J. Gastroenterol. 19 (40), 6883-6887 (2013)
Title Lentivirus-mediated shRNA interference targeting cyclooxygenase-2 inhibits growth of human non-small cell lung cancer .
Author Li T, Lu J and Zhong Y.
Journal J BUON 18 (4), 908-914 (2013)
Title Structure of the human cyclo-oxygenase-2 gene .
Author Appleby SB, Ristimaki A, Neilson K, Narko K and Hla T.
Journal Biochem. J. 302 (PT 3), 723-727 (1994)
Title Inducible isoforms of cyclooxygenase and nitric-oxide synthase in inflammation .
Author Vane JR, Mitchell JA, Appleton I, Tomlinson A, Bishop-Bailey D, Croxtall J and Willoughby DA.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (6), 2046-2050 (1994)
Title Human cyclooxygenase-2 cDNA .
Author Hla T and Neilson K.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (16), 7384-7388 (1992)
Title Prostaglandin endoperoxide synthase gene structure: identification of the transcriptional start site and 5'-flanking regulatory sequences .
Author Kraemer SA, Meade EA and DeWitt DL.
Journal Arch. Biochem. Biophys. 293 (2), 391-400 (1992)
Title Detection and isolation of an endoperoxide intermediate in prostaglandin biosynthesis .
Author Hamberg,M. and Samuelsson,B.
Journal Proc. Natl. Acad. Sci. U.S.A. 70 (3), 899-903 (1973)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.