• THAT   AND
  • THAT   AND


Homo sapiens chemokine (C-C motif) ligand 4-like 1 (CCL4L1), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001001435 Homo sapiens chemokine (C-C motif) ligand 4-like 1 (CCL4L1), mRNA. Full Lenth $195.46
ORF Sequence $159.00


RefSeq Version NM_001001435.2, 48949791
Length 674 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 4-like 1 (CCL4L1), mRNA.
Product C-C motif chemokine 4-like precursor
Comment

Summary: This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more centromeric gene. [provided by RefSeq].

RefSeq NP_001001435.1
CDS 77..355
Exon (1)1..152
Exon (2)1..152
Exon (3)153..267
Exon (4)268..659
Translation MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ PAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
14+a, gdbSNP:56248205
complement(41)-t, gdbSNP:2277660
110+a, gdbSNP:1049752
complement(135)-g, adbSNP:4113763
complement(162)-t, adbSNP:3744596
193+c, tdbSNP:56184815
complement(210)-t, cdbSNP:3744595
Gene SymbolCCL4L1
Gene SynonymAT744.2; CCL4L; CCL4L2; LAG-1; LAG1; SCYA4L
Chromosome17
Locus Map17q12
All Transcripts NM_001001435
Title Copy number variation in chemokine superfamily: the complex scene of CCL3L-CCL4L genes in health and disease .
Author Colobran,R., Pedrosa,E., Carretero-Iglesia,L. and Juan,M.
Journal Clin. Exp. Immunol. 162 (1), 41-52 (2010)
Title Chemokine expression patterns in the systemic and genital tract compartments are associated with HIV-1 infection in women from Benin .
Author Lajoie,J., Poudrier,J., Massinga Loembe,M., Guedou,F., Leblond,F., Labbe,A.C., Alary,M. and Roger,M.
Journal J. Clin. Immunol. 30 (1), 90-98 (2010)
Title Copy number variation in the CCL4L gene is associated with susceptibility to acute rejection in lung transplantation .
Author Colobran,R., Casamitjana,N., Roman,A., Faner,R., Pedrosa,E., Arostegui,J.I., Pujol-Borrell,R., Juan,M. and Palou,E.
Journal Genes Immun. 10 (3), 254-259 (2009)
Title Combinatorial content of CCL3L and CCL4L gene copy numbers influence HIV-AIDS susceptibility in Ukrainian children .
Author Shostakovich-Koretskaya,L., Catano,G., Chykarenko,Z.A., He,W., Gornalusse,G., Mummidi,S., Sanchez,R., Dolan,M.J., Ahuja,S.S., Clark,R.A., Kulkarni,H. and Ahuja,S.K.
Journal AIDS 23 (6), 679-688 (2009)
Title A genome-wide association study identifies protein quantitative trait loci (pQTLs) .
Author Melzer,D., Perry,J.R., Hernandez,D., Corsi,A.M., Stevens,K., Rafferty,I., Lauretani,F., Murray,A., Gibbs,J.R., Paolisso,G., Rafiq,S., Simon-Sanchez,J., Lango,H., Scholz,S., Weedon,M.N., Arepalli,S., Rice,N., Washecka,N., Hurst,A., Britton,A., Henley,W., van de Leemput,J., Li,R., Newman,A.B., Tranah,G., Harris,T., Panicker,V., Dayan,C., Bennett,A., McCarthy,M.I., Ruokonen,A., Jarvelin,M.R., Guralnik,J., Bandinelli,S., Frayling,T.M., Singleton,A. and Ferrucci,L.
Journal PLoS Genet. 4 (5), E1000072 (2008)
Title The gene encoding the Act-2 cytokine. Genomic structure, HTLV-I/Tax responsiveness of 5' upstream sequences, and chromosomal localization .
Author Napolitano,M., Modi,W.S., Cevario,S.J., Gnarra,J.R., Seuanez,H.N. and Leonard,W.J.
Journal J. Biol. Chem. 266 (26), 17531-17536 (1991)
Title Cloning and expression of a lymphocyte activation gene (LAG-1) .
Author Baixeras,E., Roman-Roman,S., Jitsukawa,S., Genevee,C., Mechiche,S., Viegas-Pequignot,E., Hercend,T. and Triebel,F.
Journal Mol. Immunol. 27 (11), 1091-1102 (1990)
Title Two inflammatory mediator cytokine genes are closely linked and variably amplified on chromosome 17q .
Author Irving,S.G., Zipfel,P.F., Balke,J., McBride,O.W., Morton,C.C., Burd,P.R., Siebenlist,U. and Kelly,K.
Journal Nucleic Acids Res. 18 (11), 3261-3270 (1990)
Title A family of small inducible proteins secreted by leukocytes are members of a new superfamily that includes leukocyte and fibroblast-derived inflammatory agents, growth factors, and indicators of various activation processes .
Author Brown,K.D., Zurawski,S.M., Mosmann,T.R. and Zurawski,G.
Journal J. Immunol. 142 (2), 679-687 (1989)
Title Identification, cloning, and characterization of an immune activation gene .
Author Lipes,M.A., Napolitano,M., Jeang,K.T., Chang,N.T. and Leonard,W.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 85 (24), 9704-9708 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878