• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens growth differentiation factor 6 (GDF6), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18538 Homo sapiens growth differentiation factor 6 (GDF6), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu18538C Homo sapiens growth differentiation factor 6 (GDF6), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001001557.2, 188219580
Length 1368 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens growth differentiation factor 6 (GDF6), mRNA.
Product growth/differentiation factor 6 precursor
Comment

Summary: This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily of secreted signaling molecules. It is required for normal formation of some bones and joints in the limbs, skull, and axial skeleton. Mutations in this gene result in colobomata, which are congenital abnormalities in ocular development, and in Klippel-Feil syndrome (KFS), which is a congenital disorder of spinal segmentation. [provided by RefSeq, Jul 2008].

RefSeq NP_001001557.1
CDS 101..1468
Misc Feature(1)302..943
Misc Feature(2)1160..1465
Exon (1)1..506
Gene:GDF6
Gene Synonym:BMP-13; BMP13; CDMP2; KFM; KFS; KFS1; KFSL; LCA17; MCOP4; MCOPCB6; SCDO4; SGM1
Exon (2)507..3701
Gene:GDF6
Gene Synonym:BMP-13; BMP13; CDMP2; KFM; KFS; KFS1; KFSL; LCA17; MCOP4; MCOPCB6; SCDO4; SGM1
Translation MDTPRVLLSAVFLISFLWDLPGFQQASISSSSSSAELGSTKGMRSRKEGKMQRAPRDSDA GREGQEPQPRPQDEPRAQQPRAQEPPGRGPRVVPHEYMLSIYRTYSIAEKLGINASFFQS SKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPP AGPLHVQLFPCLSPLLLDARTLDPQGAPPAGWEVFDVWQGLRHQPWKQLCLELRAAWGEL DAGEAEARARGPQQPPPPDLRSLGFGRRVRPPQERALLVVFTRSQRKNLFAEMREQLGSA EAAGPGAGAEGSWPPPSGAPDARPWLPSPGRRRRRTAFASRHGKRHGKKSRLRCSKKPLH VNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCC VPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(74)-dbSNP:
complement(74)-g, adbSNP:200796417
complement(124)-g, cdbSNP:369859861
complement(161)-g, adbSNP:375724225
complement(172)-t, cdbSNP:367719359
complement(190)-g, cdbSNP:143020575
complement(199..201)-, gacdbSNP:141468446
complement(212)-g, cdbSNP:139075817
complement(219)-g, adbSNP:372946584
225+g, tdbSNP:121909354
complement(259)-t, cdbSNP:369474176
complement(261)-g, adbSNP:143941048
complement(267)-g, cdbSNP:375108591
complement(268)-g, cdbSNP:371969433
269+c, gdbSNP:397514725
complement(280)-t, cdbSNP:368712395
complement(330)-t, gdbSNP:35554903
complement(350)-t, cdbSNP:148321868
complement(355)-c, adbSNP:112296824
complement(373)-t, gdbSNP:200398313
complement(381)-g, cdbSNP:367883918
complement(409)-g, cdbSNP:374850065
complement(415)-g, adbSNP:370658707
complement(422)-t, cdbSNP:368498747
complement(456)-t, cdbSNP:140579014
complement(468)-g, adbSNP:374385671
complement(518)-dbSNP:
complement(518)-g, cdbSNP:370351474
complement(520)-g, adbSNP:375769410
complement(529)-g, adbSNP:375992269
complement(533)-t, gdbSNP:372590219
complement(535)-t, cdbSNP:369127445
complement(583)-c, adbSNP:200585226
695+a, gdbSNP:387906794
846+a, cdbSNP:121909352
858+a, tdbSNP:121909355
complement(952)-g, cdbSNP:74498875
966+c, tdbSNP:63751220
complement(1036)-g, cdbSNP:148861809
complement(1062)-t, cdbSNP:376698111
complement(1064)-t, cdbSNP:200317462
1080+a, cdbSNP:121909356
complement(1125)-t, cdbSNP:369743492
complement(1136)-g, adbSNP:374231223
complement(1171)-t, cdbSNP:151332138
1371+a, gdbSNP:121909353
complement(1382)-t, cdbSNP:144578143
complement(1402)-g, adbSNP:138730867
complement(1404)-g, adbSNP:140782427
complement(1410)-t, cdbSNP:376427985
complement(1470)-t, g, cdbSNP:200117791
complement(1496)-t, cdbSNP:367847329
complement(1499)-t, gdbSNP:200800110
complement(1525)-t, cdbSNP:113905230
complement(1612)-t, cdbSNP:115887213
complement(1633)-g, adbSNP:117125307
complement(1640)-t, cdbSNP:115207215
complement(1739..1740)-, g, gadbSNP:71275339
complement(1740)-, adbSNP:112042997
complement(1742)-g, adbSNP:188749696
complement(1746)-g, adbSNP:113422438
complement(1785..1788)-, atagdbSNP:200531225
complement(1787)-t, gdbSNP:10626175
complement(1787)-t, gdbSNP:79053711
complement(1816)-g, adbSNP:192913456
complement(1822)-t, cdbSNP:145819797
complement(1848)-t, cdbSNP:2440199
complement(1861)-g, adbSNP:367862504
complement(1901)-t, cdbSNP:190630861
complement(1937)-g, cdbSNP:141772484
complement(2045)-t, adbSNP:75587676
complement(2118)-g, cdbSNP:185707933
complement(2179)-c, adbSNP:73698505
complement(2310)-g, adbSNP:192657480
complement(2358)-g, adbSNP:149860626
complement(2359)-t, cdbSNP:376103537
complement(2466)-g, cdbSNP:114201878
complement(2552)-t, gdbSNP:77181285
complement(2558)-g, cdbSNP:80085212
complement(2607)-t, cdbSNP:186743623
complement(2794)-g, adbSNP:183681247
complement(2862)-t, cdbSNP:372865149
complement(2897..2898)-, ctdbSNP:139734303
complement(3139)-g, adbSNP:191538930
complement(3446)-t, cdbSNP:112542818
complement(3469)-t, cdbSNP:36028712
complement(3590)-t, gdbSNP:183472001
complement(3591)-c, adbSNP:117422179
3638+g, tdbSNP:141085775
complement(3641)-g, cdbSNP:368840975
complement(3645)-c, adbSNP:191767957
complement(3663)-g, adbSNP:114060293
complement(3682)-g, adbSNP:188995955
complement(3684)-g, adbSNP:7003079
complement(3696)-g, adbSNP:151048799
Gene SymbolGDF6
Gene SynonymBMP-13; BMP13; CDMP2; KFM; KFS; KFS1; KFSL; LCA17; MCOP4; MCOPCB6; SCDO4; SGM1
Chromosome8
Locus Map8q22.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001001557 Homo sapiens growth differentiation factor 6 (GDF6), mRNA. In-stock $99.00 TBD
Title Contribution of growth differentiation factor 6-dependent cell survival to early-onset retinal dystrophies .
Author Asai-Coakwell M, March L, Dai XH, Duval M, Lopez I, French CR, Famulski J, De Baere E, Francis PJ, Sundaresan P, Sauve Y, Koenekoop RK, Berry FB, Allison WT, Waskiewicz AJ and Lehmann OJ.
Journal Hum. Mol. Genet. 22 (7), 1432-1442 (2013)
Title High temperature requirement factor A1 (HTRA1) gene regulates angiogenesis through transforming growth factor-beta family member growth differentiation factor 6 .
Author Zhang L, Lim SL, Du H, Zhang M, Kozak I, Hannum G, Wang X, Ouyang H, Hughes G, Zhao L, Zhu X, Lee C, Su Z, Zhou X, Shaw R, Geum D, Wei X, Zhu J, Ideker T, Oka C, Wang N, Yang Z, Shaw PX and Zhang K.
Journal J. Biol. Chem. 287 (2), 1520-1526 (2012)
Title Divergent activities of osteogenic BMP2, and tenogenic BMP12 and BMP13 independent of receptor binding affinities .
Author Berasi SP, Varadarajan U, Archambault J, Cain M, Souza TA, Abouzeid A, Li J, Brown CT, Dorner AJ, Seeherman HJ and Jelinsky SA.
Journal Growth Factors 29 (4), 128-139 (2011)
Title Mutational screening of CHX10, GDF6, OTX2, RAX and SOX2 genes in 50 unrelated microphthalmia-anophthalmia-coloboma (MAC) spectrum cases .
Author Gonzalez-Rodriguez J, Pelcastre EL, Tovilla-Canales JL, Garcia-Ortiz JE, Amato-Almanza M, Villanueva-Mendoza C, Espinosa-Mattar Z and Zenteno JC.
Journal Br J Ophthalmol 94 (8), 1100-1104 (2010)
Title BMP12 and BMP13 gene transfer induce ligamentogenic differentiation in mesenchymal progenitor and anterior cruciate ligament cells .
Author Haddad-Weber M, Prager P, Kunz M, Seefried L, Jakob F, Murray MM, Evans CH, Noth U and Steinert AF.
Journal Cytotherapy 12 (4), 505-513 (2010)
Title Ectopic induction of tendon and ligament in rats by growth and differentiation factors 5, 6, and 7, members of the TGF-beta gene family .
Author Wolfman NM, Hattersley G, Cox K, Celeste AJ, Nelson R, Yamaji N, Dube JL, DiBlasio-Smith E, Nove J, Song JJ, Wozney JM and Rosen V.
Journal J. Clin. Invest. 100 (2), 321-330 (1997)
Title Cartilage morphogenesis: role of bone and cartilage morphogenetic proteins, homeobox genes and extracellular matrix .
Author Reddi AH.
Journal Matrix Biol. 14 (8), 599-606 (1995)
Title Cartilage-derived morphogenetic proteins. New members of the transforming growth factor-beta superfamily predominantly expressed in long bones during human embryonic development .
Author Chang SC, Hoang B, Thomas JT, Vukicevic S, Luyten FP, Ryba NJ, Kozak CA, Reddi AH and Moos M Jr.
Journal J. Biol. Chem. 269 (45), 28227-28234 (1994)
Title Limb alterations in brachypodism mice due to mutations in a new member of the TGF beta-superfamily .
Author Storm EE, Huynh TV, Copeland NG, Jenkins NA, Kingsley DM and Lee SJ.
Journal Nature 368 (6472), 639-643 (1994)
Title Cervical vertebral fusion (Klippel-Feil) syndrome with consanguineous parents .
Author Juberg,R.C. and Gershanik,J.J.
Journal J. Med. Genet. 13 (3), 246-249 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.