• THAT   AND
  • THAT   AND


Homo sapiens LIM homeobox 8 (LHX8), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001001933 Homo sapiens LIM homeobox 8 (LHX8), mRNA. Full Lenth $693.97
ORF Sequence $310.59


RefSeq Version NM_001001933.1, 50083286
Length 2393 bp
Structure linear
Update Date 10-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens LIM homeobox 8 (LHX8), mRNA.
Product LIM/homeobox protein Lhx8
Comment

Summary: Members of the LIM homeobox gene family, such as LHX8, encode transcription regulators that share common structural features. They all contain 2 tandemly repeated cysteine-rich double-zinc finger motifs, called LIM domains, in addition to a homeodomain. The homeodomain is a DNA-binding domain, and the LIM domains are essential for regulating the activity of these molecules by interacting with other proteins. Members of the LIM homeobox gene family are required for the patterning or the specification and differentiation of different cell types during embryonic development (Zhao et al., 1999 [PubMed 10611327]).[supplied by OMIM]. COMPLETENESS: complete on the 3' end.

RefSeq NP_001001933.1
CDS 665..1735
Exon (1)1..175
Exon (2)1..175
Exon (3)176..682
Exon (4)683..769
Exon (5)770..931
Exon (6)932..1053
Exon (7)1054..1274
Exon (8)1275..1378
Exon (9)1379..1474
Exon (10)1475..1658
Exon (11)1659..2373
Translation MQILSRCQGLMSEECGRTTALAAGRTRKGAGEEGLVSPEGAGDEDSCSSSAPLSPSSSPR SMASGSGCPPGKCVCNSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDK DIFCKLDYFRRYGTRCSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALV EEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDVNHPKPAKRARTSFTADQLQVM QAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVSPNHSSSTPVTAVPPS RLSPPMLEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQLPISHT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
36+c, gdbSNP:41289228
241+g, tdbSNP:41289230
433+c, tdbSNP:111227275
595+a, gdbSNP:41289232
653+c, gdbSNP:41289234
695+a, cdbSNP:116590034
1105+c, tdbSNP:12084309
1477+g, tdbSNP:79714503
1513+c, tdbSNP:941032
1638+c, tdbSNP:34889650
1769+a, tdbSNP:41306167
1786+a, gdbSNP:41301265
2300+g, tdbSNP:80025146
2311+a, gdbSNP:4949795
Gene SymbolLHX8
Gene SynonymLhx7
Chromosome1
Locus Map1p31.1
All Transcripts NM_001001933
Title Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate .
Author Nikopensius,T., Jagomagi,T., Krjutskov,K., Tammekivi,V., Saag,M., Prane,I., Piekuse,L., Akota,I., Barkane,B., Krumina,A., Ambrozaityte,L., Matuleviciene,A., Kucinskiene,Z.A., Lace,B., Kucinskas,V. and Metspalu,A.
Journal Birth Defects Res. Part A Clin. Mol. Teratol. 88 (9), 748-756 (2010)
Title MTHFR and MSX1 contribute to the risk of nonsyndromic cleft lip/palate .
Author Jagomagi,T., Nikopensius,T., Krjutskov,K., Tammekivi,V., Viltrop,T., Saag,M. and Metspalu,A.
Journal Eur. J. Oral Sci. 118 (3), 213-220 (2010)
Title Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia .
Author Jugessur,A., Shi,M., Gjessing,H.K., Lie,R.T., Wilcox,A.J., Weinberg,C.R., Christensen,K., Boyles,A.L., Daack-Hirsch,S., Nguyen,T.T., Christiansen,L., Lidral,A.C. and Murray,J.C.
Journal PLoS ONE 5 (7), E11493 (2010)
Title Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts .
Author Vieira,A.R., McHenry,T.G., Daack-Hirsch,S., Murray,J.C. and Marazita,M.L.
Journal Genet. Med. 10 (9), 668-674 (2008)
Title Analysis of LHX8 mutation in premature ovarian failure .
Author Qin,Y., Zhao,H., Kovanci,E., Simpson,J.L., Chen,Z.J. and Rajkovic,A.
Journal Fertil. Steril. 89 (4), 1012-1014 (2008)
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z., Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S., McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J., Dunham,I., Hill,D.E. and Vidal,M.
Journal Genomics 89 (3), 307-315 (2007)
Title Oogenesis requires germ cell-specific transcriptional regulators Sohlh1 and Lhx8 .
Author Pangas,S.A., Choi,Y., Ballow,D.J., Zhao,Y., Westphal,H., Matzuk,M.M. and Rajkovic,A.
Journal Proc. Natl. Acad. Sci. U.S.A. 103 (21), 8090-8095 (2006)
Title Medical sequencing of candidate genes for nonsyndromic cleft lip and palate .
Author Vieira,A.R., Avila,J.R., Daack-Hirsch,S., Dragan,E., Felix,T.M., Rahimov,F., Harrington,J., Schultz,R.R., Watanabe,Y., Johnson,M., Fang,J., O'Brien,S.E., Orioli,I.M., Castilla,E.E., Fitzpatrick,D.R., Jiang,R., Marazita,M.L. and Murray,J.C.
Journal PLoS Genet. 1 (6), E64 (2005)
Title Isolated cleft palate in mice with a targeted mutation of the LIM homeobox gene lhx8 .
Author Zhao,Y., Guo,Y.J., Tomac,A.C., Taylor,N.R., Grinberg,A., Lee,E.J., Huang,S. and Westphal,H.
Journal Proc. Natl. Acad. Sci. U.S.A. 96 (26), 15002-15006 (1999)
Title Structure and chromosomal localization of a murine LIM/homeobox gene, Lhx8 .
Author Kitanaka,J., Takemura,M., Matsumoto,K., Mori,T. and Wanaka,A.
Journal Genomics 49 (2), 307-309 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878