• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibroblast growth factor receptor-like 1 (FGFRL1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001004356 Homo sapiens fibroblast growth factor receptor-like 1 (FGFRL1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_001004356.2, 62388872
Length 3215 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens fibroblast growth factor receptor-like 1 (FGFRL1), transcript variant 1, mRNA.
Product fibroblast growth factor receptor-like 1 precursor
Comment

Summary: The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. A marked difference between this gene product and the other family members is its lack of a cytoplasmic tyrosine kinase domain. The result is a transmembrane receptor that could interact with other family members and potentially inhibit signaling. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript.

RefSeq NP_001004356.1
CDS 150..1664
Misc Feature(1)66..68
Misc Feature(2)66..68
Misc Feature(3)246..497
Misc Feature(4)288..497
Misc Feature(5)618..863
Misc Feature(6)order(624..626,630..632,636..638)
Misc Feature(7)order(627..629,648..656,660..662)
Misc Feature(8)642..833
Misc Feature(9)906..1214
Misc Feature(10)930..1217
Misc Feature(11)1284..1346
Exon (1)1..133
Gene:FGFRL1
Gene Synonym:FGFR5; FHFR
Exon (2)134..228
Gene:FGFRL1
Gene Synonym:FGFR5; FHFR
Exon (3)229..501
Gene:FGFRL1
Gene Synonym:FGFR5; FHFR
Exon (4)502..582
Gene:FGFRL1
Gene Synonym:FGFR5; FHFR
Exon (5)583..867
Gene:FGFRL1
Gene Synonym:FGFR5; FHFR
Exon (6)868..1221
Gene:FGFRL1
Gene Synonym:FGFR5; FHFR
Exon (7)1222..3215
Gene:FGFRL1
Gene Synonym:FGFR5; FHFR
Translation MTPSPLLLLLLPPLLLGAFPPAAAARGPPKMADKVVPRQVARLGRTVRLQCPVEGDPPPL TMWTKDGRTIHSGWSRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDI SPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRP DITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQ RTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGG QKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPK PPGPPVASSSSATSLPWPVVIGIPAGAVFILGTLLLWLCQAQKKPCTPAPAPPLPGHRPP GTARDRSGDKDLPSLAALSAGPGVGLCEEHGSPAAPQHLLGPGPVAGPKLYPKLYTDIHT HTHTHSHTHSHVEGKVHQHIHYQC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
139+dbSNP:
139+c, gdbSNP:368027099
143+c, gdbSNP:372270864
167+a, gdbSNP:376206035
209+a, gdbSNP:4647942
244+dbSNP:
244+c, tdbSNP:78299800
263+a, gdbSNP:201988101
268+g, tdbSNP:199787006
290+g, tdbSNP:373335067
292+a, gdbSNP:375489366
347+c, tdbSNP:201067344
351+c, tdbSNP:191062034
365+a, cdbSNP:372553975
383+a, cdbSNP:61733101
414+c, gdbSNP:377619943
420+c, tdbSNP:369657280
426+a, gdbSNP:71604335
435+a, gdbSNP:200736918
436+c, tdbSNP:142763226
440+c, g, tdbSNP:113418020
447+a, gdbSNP:371631827
449+a, gdbSNP:147343114
477+a, gdbSNP:372607043
485+c, tdbSNP:139057147
487+c, tdbSNP:377060032
488+c, tdbSNP:200350712
527+dbSNP:
527+c, tdbSNP:371664807
566+c, tdbSNP:376193356
591+dbSNP:
591+c, tdbSNP:201696860
638+a, cdbSNP:113814624
650+c, tdbSNP:140852364
666+a, gdbSNP:377175884
690+a, gdbSNP:201262483
710+c, tdbSNP:200618237
724+c, tdbSNP:369436907
725+a, gdbSNP:199798050
727+a, g, tdbSNP:4647937
728+c, tdbSNP:374115931
737+c, tdbSNP:144863877
813+c, tdbSNP:148556821
821+a, gdbSNP:144361678
825+c, tdbSNP:201667493
826+a, gdbSNP:146608674
872+dbSNP:
872+a, gdbSNP:116837147
876+c, tdbSNP:143714694
887+c, tdbSNP:114935241
888+a, gdbSNP:368039756
908+c, tdbSNP:140460823
929+c, tdbSNP:371754554
961+a, gdbSNP:370772573
977+a, gdbSNP:58679007
997+a, gdbSNP:372119720
999+g, tdbSNP:376072293
1013+c, tdbSNP:138109269
1014+a, gdbSNP:200852436
1017+a, gdbSNP:149112646
1025+c, tdbSNP:370405185
1039+a, gdbSNP:372708838
1040+c, tdbSNP:4647946
1046+c, tdbSNP:138843839
1073+a, gdbSNP:375942692
1079+c, tdbSNP:142743042
1087+c, tdbSNP:200863947
1090+a, gdbSNP:370584141
1097+c, tdbSNP:147385493
1121+c, gdbSNP:202228086
1129+a, gdbSNP:147980100
1131+a, gdbSNP:200153294
1135+a, gdbSNP:374222149
1136+c, tdbSNP:368634271
1139+a, gdbSNP:141649779
1169+c, tdbSNP:138509526
1179+a, gdbSNP:139387602
1200+a, gdbSNP:374309032
1229..1230+dbSNP:
1229..1230+, cdbSNP:369065988
1234+a, cdbSNP:4647930
1255+c, tdbSNP:368961378
1276+c, tdbSNP:371943795
1279+a, gdbSNP:376903367
1283+c, tdbSNP:111246053
1284+a, gdbSNP:201440347
1292+c, tdbSNP:146112374
1299+c, tdbSNP:373660136
1304+a, cdbSNP:140148549
1307+c, tdbSNP:375677549
1308+a, gdbSNP:202037959
1373+c, tdbSNP:201062727
1374+a, gdbSNP:373506035
1376+a, gdbSNP:61734883
1398+a, cdbSNP:201377348
1400+c, tdbSNP:370211317
1405+a, cdbSNP:200338999
1408+a, cdbSNP:375985073
1409+a, gdbSNP:201785648
1415+a, gdbSNP:375150331
1419+c, tdbSNP:368437012
1420+g, tdbSNP:4647931
1423+a, gdbSNP:374653229
1430+c, tdbSNP:367617448
1431+a, gdbSNP:200822222
1434+a, gdbSNP:376736117
1438+a, gdbSNP:367966622
1451+a, gdbSNP:145786390
1466+c, tdbSNP:371849695
1467+a, gdbSNP:376400181
1496+a, gdbSNP:200350207
1498+a, gdbSNP:182915641
1508+a, gdbSNP:373825808
1532+c, tdbSNP:148505744
1539+c, gdbSNP:80019124
1540+c, tdbSNP:4647932
1572+c, tdbSNP:375421159
1584..1585+, cadbSNP:145808953
1606+c, gdbSNP:199548478
1621+a, gdbSNP:372496076
1623+a, gdbSNP:138327840
1630+a, gdbSNP:149625647
1654+a, gdbSNP:111608568
1655+g, tdbSNP:144318134
1666+c, tdbSNP:370665283
1673+a, gdbSNP:372960046
1692+c, gdbSNP:377284409
1696+a, gdbSNP:370871387
1770+a, gdbSNP:61007088
1816..1817+, acdbSNP:147695405
1830..1833+, acacdbSNP:113926759
1841+a, gdbSNP:4647939
1869+a, gdbSNP:371059354
1899..1900+, cgdbSNP:201031675
1901..1902+, cadbSNP:4647945
1906..1907+, acdbSNP:372298935
1926+c, tdbSNP:147461484
1959+a, cdbSNP:73070424
1960+a, gdbSNP:115824203
1963+c, gdbSNP:187595155
2025+a, gdbSNP:372948683
2028+c, tdbSNP:139909269
2029+a, gdbSNP:116173564
2046..2047+, acdbSNP:376462828
2086+c, tdbSNP:11538025
2087+c, tdbSNP:201858459
2088..2091+, tgcadbSNP:369182316
2092..2118+, gatatggtatccggacacacacgtgcadbSNP:35896028
2098..2100+ctg, gtadbSNP:386670451
2103+c, tdbSNP:377108343
2107..2108+, gcdbSNP:376865502
2131+c, tdbSNP:192541751
2155+g, tdbSNP:28602600
2157..2158+, acdbSNP:371335089
2183..2184+, acdbSNP:56398186
2184..2185+, acdbSNP:367952828
2198..2201+acgt, gcdbSNP:386670452
2199..2200+, acdbSNP:397935892
2200+a, gdbSNP:199852820
2201+c, tdbSNP:1064838
2218+c, tdbSNP:28668809
2226+c, gdbSNP:1064839
2322+a, gdbSNP:184928800
2331+c, tdbSNP:142792896
2335..2336+, acdbSNP:35640602
2351+a, gdbSNP:151232580
2363+a, gdbSNP:115679552
2386..2389+, acacdbSNP:369250502
2426..2427+, cadbSNP:57445348
2438+c, gdbSNP:187572457
2480..2481+, atdbSNP:34428342
2515+a, gdbSNP:370714398
2531+c, tdbSNP:192813350
2541+c, tdbSNP:4647936
2541+c, tdbSNP:201367919
2542+a, gdbSNP:4647943
2558+a, gdbSNP:140919592
2621..2622+, acdbSNP:201331455
2637+a, cdbSNP:189183107
complement(2658)-g, adbSNP:3733350
2742+c, tdbSNP:370896791
2748..2759+, tgtccccgcctcdbSNP:376088822
2748+a, tdbSNP:148837233
2755+g, tdbSNP:143441743
2772..2783+, catccccgcctcdbSNP:4647941
2773+a, gdbSNP:370377465
2800+c, tdbSNP:192584184
2865+a, gdbSNP:4647938
2920+c, gdbSNP:4647940
3046+c, tdbSNP:113502766
3078+c, tdbSNP:377102874
3082+a, gdbSNP:114230525
3098..3099+, cdbSNP:59896854
3104..3105+, cdbSNP:397941425
3104+c, tdbSNP:375839578
3157+c, gdbSNP:148169986
3173+c, tdbSNP:118095428
3209+c, tdbSNP:141073382
Gene SymbolFGFRL1
Gene SynonymFGFR5; FHFR
Chromosome4
Locus Map4p16
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001004356 Homo sapiens fibroblast growth factor receptor-like 1 (FGFRL1), transcript variant 1, mRNA. On-demand TBD TBD
NM_021923 Homo sapiens fibroblast growth factor receptor-like 1 (FGFRL1), transcript variant 3, mRNA. On-demand TBD TBD
NM_001004358 Homo sapiens fibroblast growth factor receptor-like 1 (FGFRL1), transcript variant 2, mRNA. On-demand TBD TBD
Title An integrated genomic, transcriptional and protein investigation of FGFRL1 as a putative 4p16.3 deletion target in bladder cancer .
Author di Martino E, Taylor CF, Roulson JA and Knowles MA.
Journal Genes Chromosomes Cancer 52 (9), 860-871 (2013)
Title Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population .
Author Comuzzie AG, Cole SA, Laston SL, Voruganti VS, Haack K, Gibbs RA and Butte NF.
Journal PLoS ONE 7 (12), E51954 (2012)
Title Interaction of the receptor FGFRL1 with the negative regulator Spred1 .
Author Zhuang L, Villiger P and Trueb B.
Journal Cell. Signal. 23 (9), 1496-1504 (2011)
Title MicroRNA-210 regulates cancer cell proliferation through targeting fibroblast growth factor receptor-like 1 (FGFRL1) .
Author Tsuchiya S, Fujiwara T, Sato F, Shimada Y, Tanaka E, Sakai Y, Shimizu K and Tsujimoto G.
Journal J. Biol. Chem. 286 (1), 420-428 (2011)
Title Rapid fusion and syncytium formation of heterologous cells upon expression of the FGFRL1 receptor .
Author Steinberg F, Gerber SD, Rieckmann T and Trueb B.
Journal J. Biol. Chem. 285 (48), 37704-37715 (2010)
Title Signal peptide prediction based on analysis of experimentally verified cleavage sites .
Author Zhang Z and Henzel WJ.
Journal Protein Sci. 13 (10), 2819-2824 (2004)
Title Characterization of FGFRL1, a novel fibroblast growth factor (FGF) receptor preferentially expressed in skeletal tissues .
Author Trueb B, Zhuang L, Taeschler S and Wiedemann M.
Journal J. Biol. Chem. 278 (36), 33857-33865 (2003)
Title Identification of a new fibroblast growth factor receptor, FGFR5 .
Author Sleeman M, Fraser J, McDonald M, Yuan S, White D, Grandison P, Kumble K, Watson JD and Murison JG.
Journal Gene 271 (2), 171-182 (2001)
Title A novel fibroblast growth factor receptor-5 preferentially expressed in the pancreas(1) .
Author Kim I, Moon S, Yu K, Kim U and Koh GY.
Journal Biochim. Biophys. Acta 1518 (1-2), 152-156 (2001)
Title Characterization of a novel protein (FGFRL1) from human cartilage related to FGF receptors .
Author Wiedemann M and Trueb B.
Journal Genomics 69 (2), 275-279 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.