• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s, mRNA.


RefSeq Accession Definition Services Price Order
NM_001005915 Homo sapiens v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s, mRNA. ORF Sequence $160.08
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001005915.1, 54792101
Length 1050 bp
Structure linear
Update Date 20-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s, mRNA.
Product receptor tyrosine-protein kinase erbB-3 isoform s precursor
Comment

Summary: This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (s) lacks many 3' exons found in variant 1 and contains an alternate 3' exon of its own, that causes a frameshift. The resulting isoform (s) is shorter lacking the intermembrane region present in isoform 1, and is secreted outside the cell.

RefSeq NP_001005915.1
CDS 194..745
Misc Feature(1)137..139
Misc Feature(2)359..>565
Exon (1)1..275
Gene:ERBB3
Gene Synonym:c-erbB-3; c-erbB3; ErbB-3; erbB3-S; HER3; LCCS2; MDA-BF-1; p180-ErbB3; p45-sErbB3; p85-sErbB3
Exon (2)276..427
Gene:ERBB3
Gene Synonym:c-erbB-3; c-erbB3; ErbB-3; erbB3-S; HER3; LCCS2; MDA-BF-1; p180-ErbB3; p45-sErbB3; p85-sErbB3
Exon (3)428..1050
Gene:ERBB3
Gene Synonym:c-erbB-3; c-erbB3; ErbB-3; erbB3-S; HER3; LCCS2; MDA-BF-1; p180-ErbB3; p45-sErbB3; p85-sErbB3
Translation MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM LNYNTNSSHALRQLRLTQLTGQFPMVPSGLTPQPAQDWYLLDDDPRLLTLSASSKVPVTL AAV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1+dbSNP:
1+a, tdbSNP:113949839
246..247+, gdbSNP:67420827
252+a, cdbSNP:34379766
271+a, gdbSNP:190034531
282+dbSNP:
282+c, tdbSNP:56017157
367+a, gdbSNP:148902499
396+c, tdbSNP:142735651
410+a, g, tdbSNP:143770796
424+a, gdbSNP:199806001
451+dbSNP:
451+c, tdbSNP:201378576
458+a, gdbSNP:77228285
479+a, gdbSNP:200856864
495+a, gdbSNP:201479792
499+a, cdbSNP:142358877
500+c, tdbSNP:146486757
507+a, cdbSNP:984896
508+a, gdbSNP:185577186
657+c, tdbSNP:199586304
737+a, gdbSNP:188955993
863+c, tdbSNP:79581177
892+c, tdbSNP:148655905
Gene SymbolERBB3
Gene Synonymc-erbB-3; c-erbB3; ErbB-3; erbB3-S; HER3; LCCS2; MDA-BF-1; p180-ErbB3; p45-sErbB3; p85-sErbB3
Chromosome12
Locus Map12q13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001005915 Homo sapiens v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s, mRNA. Full Length $304.50
ORF Sequence $160.08
NM_001982 Homo sapiens v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, mRNA. Full Length $2594.25
ORF Sequence $1410.15
Title Neuregulin 1-HER axis as a key mediator of hyperglycemic memory effects in breast cancer .
Author Park,J., Sarode,V.R., Euhus,D., Kittler,R. and Scherer,P.E.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (51), 21058-21063 (2012)
Title HER3 overexpression is a prognostic indicator of extrahepatic cholangiocarcinoma .
Author Lee,H.J., Chung,J.Y., Hewitt,S.M., Yu,E. and Hong,S.M.
Journal Virchows Arch. 461 (5), 521-530 (2012)
Title Association between -276 C/T polymorphism of the ERBB3 gene and lung cancer risk in a Korean population .
Author Sung,J.S., Jin,L., Jo,U., Park,K.H. and Kim,Y.H.
Journal Anticancer Res. 32 (10), 4433-4437 (2012)
Title Activated HER-receptors in predicting outcome of ER-positive breast cancer patients treated with adjuvant endocrine therapy .
Author Larsen,M.S., Bjerre,K., Lykkesfeldt,A.E., Giobbie-Hurder,A., Laenkholm,A.V., Henriksen,K.L., Ejlertsen,B. and Rasmussen,B.B.
Journal Breast 21 (5), 662-668 (2012)
Title Dynamically varying interactions between heregulin and ErbB proteins detected by single-molecule analysis in living cells .
Author Hiroshima,M., Saeki,Y., Okada-Hatakeyama,M. and Sako,Y.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (35), 13984-13989 (2012)
Title Heregulin-dependent regulation of HER2/neu oncogenic signaling by heterodimerization with HER3 .
Author Wallasch,C., Weiss,F.U., Niederfellner,G., Jallal,B., Issing,W. and Ullrich,A.
Journal EMBO J. 14 (17), 4267-4275 (1995)
Title Cooperative signaling of ErbB3 and ErbB2 in neoplastic transformation and human mammary carcinomas .
Author Alimandi,M., Romano,A., Curia,M.C., Muraro,R., Fedi,P., Aaronson,S.A., Di Fiore,P.P. and Kraus,M.H.
Journal Oncogene 10 (9), 1813-1821 (1995)
Title Coexpression of erbB2 and erbB3 proteins reconstitutes a high affinity receptor for heregulin .
Author Sliwkowski,M.X., Schaefer,G., Akita,R.W., Lofgren,J.A., Fitzpatrick,V.D., Nuijens,A., Fendly,B.M., Cerione,R.A., Vandlen,R.L. and Carraway,K.L. III.
Journal J. Biol. Chem. 269 (20), 14661-14665 (1994)
Title Molecular cloning and expression of an additional epidermal growth factor receptor-related gene .
Author Plowman,G.D., Whitney,G.S., Neubauer,M.G., Green,J.M., McDonald,V.L., Todaro,G.J. and Shoyab,M.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (13), 4905-4909 (1990)
Title Isolation and characterization of ERBB3, a third member of the ERBB/epidermal growth factor receptor family: evidence for overexpression in a subset of human mammary tumors .
Author Kraus,M.H., Issing,W., Miki,T., Popescu,N.C. and Aaronson,S.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 86 (23), 9193-9197 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878