• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dual specificity phosphatase 13 (DUSP13), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_001007271 Homo sapiens dual specificity phosphatase 13 (DUSP13), transcript variant 1, mRNA. ORF Sequence $164.43
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001007271.1, 56117817
Length 1788 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens dual specificity phosphatase 13 (DUSP13), transcript variant 1, mRNA.
Product dual specificity protein phosphatase 13 isoform 1
Comment

Summary: Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript and encodes isoform 1, also called MDSP. Isoform 1 is expressed from the upstream open reading frame and is expressed in skeletal muscle.


CCDS Note: This CCDS representation is supported by the mRNAs AY674051.1 and AY040091.1. The transcript is a candidate for nonsense-mediated mRNA decay (NMD); however, the protein is represented based on demonstration of the endogenous protein in mouse tissues in PMID:15252030, and because there are no non-NMD transcripts that can encode this protein in either human and mouse.


##Evidence-Data-START## Transcript exon combination :: AY674051.1, AY040091.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025083, ERS025084 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_001007272.1
CDS 56..622
Misc Feature(1)167..592
Misc Feature(2)167..592
Misc Feature(3)order(344..346,437..442,449..451,458..463)
Misc Feature(4)order(344..346,440..442)
Exon (1)1..204
Gene:DUSP13
Gene Synonym:BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP
Exon (2)205..422
Gene:DUSP13
Gene Synonym:BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP
Exon (3)423..630
Gene:DUSP13
Gene Synonym:BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP
Exon (4)631..834
Gene:DUSP13
Gene Synonym:BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP
Exon (5)835..929
Gene:DUSP13
Gene Synonym:BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP
Exon (6)930..1103
Gene:DUSP13
Gene Synonym:BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP
Exon (7)1104..1324
Gene:DUSP13
Gene Synonym:BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP
Exon (8)1325..1771
Gene:DUSP13
Gene Synonym:BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP
Translation MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELW KLGITHVLNAAHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNT PGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQ QLRGAGQS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(33)-dbSNP:
complement(33)-g, cdbSNP:117837485
complement(42)-t, cdbSNP:74146287
complement(52)-, cdbSNP:35578548
complement(65)-, tdbSNP:141119561
complement(75)-g, adbSNP:201316792
complement(109)-g, adbSNP:144572839
complement(138)-c, adbSNP:140736967
complement(165)-t, cdbSNP:199659528
complement(204)-g, adbSNP:202124325
complement(220)-dbSNP:
complement(220)-t, gdbSNP:199564471
complement(273)-t, cdbSNP:7912300
complement(293)-t, cdbSNP:200260267
complement(295)-g, cdbSNP:188944686
complement(343)-g, adbSNP:144505881
complement(350)-g, adbSNP:201419297
complement(396)-g, adbSNP:111855779
complement(402)-t, cdbSNP:199694285
complement(419)-g, cdbSNP:41280430
complement(458)-dbSNP:
complement(458)-g, adbSNP:151051282
complement(468)-g, adbSNP:145460879
complement(500)-g, adbSNP:201689968
complement(501)-t, cdbSNP:200574063
complement(560)-g, adbSNP:201867641
complement(610)-g, adbSNP:141536020
complement(727)-dbSNP:
complement(727)-g, cdbSNP:147263330
complement(736)-c, adbSNP:191054422
complement(756)-g, adbSNP:112032940
complement(794)-g, adbSNP:79802987
complement(795)-t, cdbSNP:146200587
complement(853)-dbSNP:
complement(853)-t, cdbSNP:149534897
complement(874)-t, cdbSNP:6480771
complement(891)-t, cdbSNP:141678047
complement(920)-t, cdbSNP:141490960
complement(958)-dbSNP:
complement(958)-g, adbSNP:138543174
complement(974)-t, cdbSNP:150482126
complement(978)-t, cdbSNP:144649473
complement(1000)-t, gdbSNP:140951494
complement(1002)-t, cdbSNP:201328707
complement(1004)-t, gdbSNP:148137334
complement(1007)-t, gdbSNP:199994848
complement(1020)-t, cdbSNP:143742220
complement(1028)-t, cdbSNP:148981646
complement(1069)-t, cdbSNP:140630872
complement(1103)-t, gdbSNP:145851427
complement(1115)-dbSNP:
complement(1115)-t, cdbSNP:16932004
complement(1117)-g, cdbSNP:144940833
complement(1152)-g, adbSNP:61737440
complement(1208)-t, cdbSNP:147674959
complement(1236)-t, cdbSNP:3740316
complement(1240)-t, cdbSNP:139328544
complement(1241)-g, adbSNP:61737439
complement(1245)-t, cdbSNP:3740317
complement(1260)-g, adbSNP:200011059
complement(1261)-t, cdbSNP:148458852
complement(1291)-g, adbSNP:140572167
complement(1292)-t, cdbSNP:146266949
complement(1330)-dbSNP:
complement(1330)-t, cdbSNP:141878891
complement(1335)-c, adbSNP:201911810
complement(1348)-t, cdbSNP:138525529
complement(1349)-g, adbSNP:145951301
complement(1382)-t, gdbSNP:201802912
complement(1397)-t, cdbSNP:3088142
complement(1410)-t, cdbSNP:137958414
complement(1430)-g, adbSNP:150329504
complement(1431)-t, cdbSNP:140533252
complement(1444)-g, adbSNP:190062927
complement(1465)-t, cdbSNP:35536583
complement(1471)-g, adbSNP:148360130
complement(1498)-g, cdbSNP:16931996
complement(1499)-t, cdbSNP:61737441
complement(1501)-t, gdbSNP:147665549
complement(1507)-g, adbSNP:141915692
complement(1509)-t, cdbSNP:200545065
complement(1520)-t, cdbSNP:201522147
complement(1524)-t, gdbSNP:60771337
complement(1539)-t, cdbSNP:148081118
complement(1724)-t, cdbSNP:143674515
Gene SymbolDUSP13
Gene SynonymBEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP
Chromosome10
Locus Map10q22.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001007271 Homo sapiens dual specificity phosphatase 13 (DUSP13), transcript variant 1, mRNA. Full Length $518.52
ORF Sequence $164.43
NM_001007272 Homo sapiens dual specificity phosphatase 13 (DUSP13), transcript variant 2, mRNA. Full Length $308.27
ORF Sequence $216.63
NM_001007273 Homo sapiens dual specificity phosphatase 13 (DUSP13), transcript variant 3, mRNA. Full Length $394.98
ORF Sequence $254.04
NM_016364 Homo sapiens dual specificity phosphatase 13 (DUSP13), transcript variant 6, mRNA. Full Length $267.67
ORF Sequence $173.13
Title DUSP13B/TMDP inhibits stress-activated MAPKs and suppresses AP-1-dependent gene expression .
Author Katagiri,C., Masuda,K., Nomura,M., Tanoue,K., Fujita,S., Yamashita,Y., Katakura,R., Shiiba,K., Nomura,E., Sato,M., Tanuma,N. and Shima,H.
Journal Mol. Cell. Biochem. 352 (1-2), 155-162 (2011)
Title Crystal structure of human TMDP, a testis-specific dual specificity protein phosphatase: implications for substrate specificity .
Author Kim,S.J., Jeong,D.G., Yoon,T.S., Son,J.H., Cho,S.K., Ryu,S.E. and Kim,J.H.
Journal Proteins 66 (1), 239-245 (2007)
Title A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease .
Author Grupe,A., Li,Y., Rowland,C., Nowotny,P., Hinrichs,A.L., Smemo,S., Kauwe,J.S., Maxwell,T.J., Cherny,S., Doil,L., Tacey,K., van Luchene,R., Myers,A., Wavrant-De Vrieze,F., Kaleem,M., Hollingworth,P., Jehu,L., Foy,C., Archer,N., Hamilton,G., Holmans,P., Morris,C.M., Catanese,J., Sninsky,J., White,T.J., Powell,J., Hardy,J., O'Donovan,M., Lovestone,S., Jones,L., Morris,J.C., Thal,L., Owen,M., Williams,J. and Goate,A.
Journal Am. J. Hum. Genet. 78 (1), 78-88 (2006)
Title Characterization of two distinct dual specificity phosphatases encoded in alternative open reading frames of a single gene located on human chromosome 10q22.2 .
Author Chen,H.H., Luche,R., Wei,B. and Tonks,N.K.
Journal J. Biol. Chem. 279 (40), 41404-41413 (2004)
Title Molecular cloning and characterization of a novel dual-specificity protein phosphatase possibly involved in spermatogenesis .
Author Nakamura,K., Shima,H., Watanabe,M., Haneji,T. and Kikuchi,K.
Journal Biochem. J. 344 (PT 3), 819-825 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878