• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu22116 Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu22116C Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001007792.1, 56118209
Length 2283 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3, mRNA.
Product high affinity nerve growth factor receptor isoform 3
Comment

Summary: This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (3) utilizes alternate 5' exons and lacks an internal in-frame exon, compared to variant 2. Translation initiation occurs at an upstream AUG, resulting in a shorter isoform (3) with a unique N-terminus compared to isoform 2.

RefSeq NP_001007793.1
CDS 81..2363
Misc Feature(1)54..56
Misc Feature(2)267..440
Misc Feature(3)267..440
Misc Feature(4)432..560
Misc Feature(5)573..836
Misc Feature(6)582..836
Misc Feature(7)831..836
Misc Feature(8)885..1127
Misc Feature(9)912..914
Misc Feature(10)order(987..989,1035..1040,1047..1049)
Misc Feature(11)1458..1460
Misc Feature(12)1482..2321
Misc Feature(13)1500..2315
Misc Feature(14)order(1518..1532,1542..1544,1596..1598,1602..1604,
Misc Feature(15)order(1518..1523,1527..1532,1542..1544,1596..1598,
Misc Feature(16)order(1920..1922,1932..1934,2028..2042,2067..2069,
Misc Feature(17)1971..2048
Misc Feature(18)1998..2000
Misc Feature(19)2010..2012
Misc Feature(20)2013..2015
Misc Feature(21)2241..2243
Misc Feature(22)2343..2345
Exon (1)1..89
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (2)90..202
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (3)203..277
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (4)278..349
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (5)350..418
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (6)419..564
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (7)565..707
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (8)708..840
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (9)841..1167
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (10)1168..1223
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (11)1224..1326
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (12)1327..1473
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (13)1474..1604
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (14)1605..1777
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (15)1778..2018
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (16)2019..2177
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (17)2178..2571
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Translation MKEAALICLAPSVPPILTVKSWDTMQLRAARSRCTNLLAASYIENQQHLQHLELRDLRGL GELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPL HCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDD VLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAEND VGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFT EFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDP IPDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVL APEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWEL GEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFF GVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAA GMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPP ESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEV YAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
3+dbSNP:
3+a, gdbSNP:200011053
6+, cdbSNP:146775862
32+c, tdbSNP:374760070
46+a, cdbSNP:367808960
72+a, gdbSNP:200646544
complement(76)-t, cdbSNP:1800601
76+c, tdbSNP:386545589
91+dbSNP:
91+c, gdbSNP:148424816
104+c, tdbSNP:139555558
109+c, gdbSNP:376720827
113+a, cdbSNP:145596747
118+c, tdbSNP:199647144
126+a, tdbSNP:147703846
226+dbSNP:
226+a, tdbSNP:139140006
229+a, gdbSNP:55891455
complement(244)-t, cdbSNP:79678945
255+a, gdbSNP:2274496
261+c, gdbSNP:149646444
269+a, gdbSNP:147983523
271+a, gdbSNP:368671371
285+dbSNP:
285+a, gdbSNP:201509045
295+a, gdbSNP:374170641
305+c, tdbSNP:6340
316+a, gdbSNP:141592864
331+c, gdbSNP:202161010
332+a, tdbSNP:143410959
347+c, tdbSNP:149960336
371+dbSNP:
371+a, gdbSNP:200417700
414+a, gdbSNP:370483210
427+dbSNP:
427+c, tdbSNP:41267427
436+a, cdbSNP:144609655
443+c, tdbSNP:368564443
459+c, tdbSNP:141629165
460+a, gdbSNP:141021604
472+a, gdbSNP:150271893
481+a, gdbSNP:199628251
494+c, tdbSNP:144594313
495+a, gdbSNP:367836863
499+c, tdbSNP:201503610
501+a, cdbSNP:200655463
504+a, gdbSNP:267598081
506+a, cdbSNP:267598082
512+g, tdbSNP:199719847
547+c, tdbSNP:371409149
555+a, gdbSNP:200167354
560+c, gdbSNP:138608619
565+dbSNP:
565+c, gdbSNP:201185829
575+a, gdbSNP:182531655
592+a, cdbSNP:146201511
601+c, tdbSNP:148324672
602+a, gdbSNP:114320051
605+c, tdbSNP:41443444
606+a, gdbSNP:374361068
620+c, tdbSNP:147882947
621+a, gdbSNP:201192875
630+c, tdbSNP:372041586
631+a, gdbSNP:200132482
648+c, tdbSNP:202030811
652+g, tdbSNP:369478563
700+c, tdbSNP:55909005
703+g, tdbSNP:56000394
704+c, tdbSNP:41478354
768+dbSNP:
768+a, gdbSNP:35116695
777+a, gdbSNP:201509717
782+a, gdbSNP:201110800
786+c, tdbSNP:199800193
798+a, gdbSNP:145222195
803+g, tdbSNP:149204161
807+c, tdbSNP:151334385
808+a, gdbSNP:200305545
814+a, cdbSNP:138533001
825+c, tdbSNP:368040165
844+c, tdbSNP:141483265
855+a, cdbSNP:137979116
903+c, gdbSNP:374365794
917+a, gdbSNP:144015813
930+c, tdbSNP:137994522
931+a, gdbSNP:368769883
950+c, tdbSNP:368994290
951+a, gdbSNP:369367198
1011+a, gdbSNP:139875058
1014+c, tdbSNP:375878564
1027+c, tdbSNP:150651692
1037+c, gdbSNP:370518146
1050+a, gdbSNP:201035170
1058+c, tdbSNP:145823996
1066+a, gdbSNP:121964869
1069+c, tdbSNP:371498291
1070+a, gdbSNP:2274498
1129+a, gdbSNP:140644885
1133+c, tdbSNP:374700842
1155..1156+, gdbSNP:142158754
1187+dbSNP:
1187+a, gdbSNP:375382480
1208+c, tdbSNP:147438950
1209+c, gdbSNP:199826686
1254+dbSNP:
1254+g, tdbSNP:142779943
complement(1281)-t, cdbSNP:17425856
1285+a, tdbSNP:191958638
1292+c, gdbSNP:147443162
1303+a, gdbSNP:56320207
1307+a, gdbSNP:41421749
1316+c, tdbSNP:55634591
1326+c, tdbSNP:34900547
1330+dbSNP:
1330+c, tdbSNP:202108805
1331+a, gdbSNP:200937156
1383+c, tdbSNP:369642315
1410+a, gdbSNP:139731614
1437+c, tdbSNP:141404661
1445+c, tdbSNP:373181158
1446+a, gdbSNP:144901788
1494+dbSNP:
1494+a, cdbSNP:200575096
1495+a, gdbSNP:374799164
1502+c, tdbSNP:377462819
1568+c, tdbSNP:200301690
1613+dbSNP:
1613+a, gdbSNP:369063493
1632+, cdbSNP:80356675
1646+a, gdbSNP:6334
1648+a, gdbSNP:201564883
1650+a, gdbSNP:41325044
1669+c, tdbSNP:55892037
1692+c, tdbSNP:368806213
1694+c, tdbSNP:369787899
1700+c, tdbSNP:6335
1701+c, gdbSNP:121964866
1713+a, gdbSNP:150579345
1715+a, c, gdbSNP:138423540
1719+c, tdbSNP:371344688
1721..1722+, ccdbSNP:200008715
1731+a, gdbSNP:121964870
1742+a, gdbSNP:368216788
1754+c, tdbSNP:373158861
1772+c, tdbSNP:139606876
1775+c, gdbSNP:146129485
1780+dbSNP:
1780+c, gdbSNP:188270548
1782+c, tdbSNP:6336
1786+c, tdbSNP:41470746
1810+g, tdbSNP:6339
1814+g, tdbSNP:41377846
1815+c, gdbSNP:149663928
1829+a, cdbSNP:141400005
1832..1833+, tdbSNP:80356676
1832+c, tdbSNP:6338
1836+c, tdbSNP:41327750
1859+c, tdbSNP:6337
1863+c, tdbSNP:41489348
1874+c, tdbSNP:148270992
1880+a, gdbSNP:17838192
1884+c, tdbSNP:201002156
1890+c, tdbSNP:121964867
1911+g, tdbSNP:142870382
1917+c, tdbSNP:369353892
1948+c, gdbSNP:201211571
1956+c, tdbSNP:373575086
1979+c, tdbSNP:146079821
1983+a, cdbSNP:376816422
1992+g, tdbSNP:80356677
2020+dbSNP:
2020+g, tdbSNP:199905593
complement(2024)-t, cdbSNP:34271945
2028+a, gdbSNP:41358549
2042+c, gdbSNP:55970329
2056+c, tdbSNP:121964868
2057+a, gdbSNP:377730927
2060+c, tdbSNP:56008523
2076+c, tdbSNP:374918502
2077+g, tdbSNP:200022271
2085+a, tdbSNP:200935209
2100+a, gdbSNP:370593942
2111+c, tdbSNP:147776488
2114+c, tdbSNP:145139769
2141+c, tdbSNP:140852621
2171+c, tdbSNP:145656213
2174+a, gdbSNP:55668752
2194+dbSNP:
2194+c, tdbSNP:145081333
2243+c, tdbSNP:141540032
2244+a, gdbSNP:62640939
2249+a, gdbSNP:41436146
2254+a, gdbSNP:201891311
2306+c, tdbSNP:370504033
2307+a, gdbSNP:374957692
2311+a, c, gdbSNP:35669708
2340+a, gdbSNP:55948542
2367+g, tdbSNP:376191817
2369+c, tdbSNP:370807813
2370+g, tdbSNP:145060242
2375+g, tdbSNP:41504244
2394+a, gdbSNP:876359
2412+c, gdbSNP:149115325
2466+a, gdbSNP:371153427
2494+a, gdbSNP:141728717
Gene SymbolNTRK1
Gene SynonymMTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Chromosome1
Locus Map1q21-q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001007792 Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3, mRNA. In-stock $99.00 5-7
NM_001007792 Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3, mRNA. In-stock $99.00 5-7
NM_001007792 Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3, mRNA. In-stock $99.00 5-7
Title Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism .
Author Corominas R, Yang X, Lin GN, Kang S, Shen Y, Ghamsari L, Broly M, Rodriguez M, Tam S, Trigg SA, Fan C, Yi S, Tasan M, Lemmens I, Kuang X, Zhao N, Malhotra D, Michaelson JJ, Vacic V, Calderwood MA, Roth FP, Tavernier J, Horvath S, Salehi-Ashtiani K, Korkin D, Sebat J, Hill DE, Hao T, Vidal M and Iakoucheva LM.
Journal Nat Commun 5, 3650 (2014)
Title c-Src activation through a TrkA and c-Src interaction is essential for cell proliferation and hematological malignancies .
Author Kim MS, Kim GM, Choi YJ, Kim HJ, Kim YJ and Jin W.
Journal Biochem. Biophys. Res. Commun. 441 (2), 431-437 (2013)
Title Oncogenic and drug-sensitive NTRK1 rearrangements in lung cancer .
Author Vaishnavi A, Capelletti M, Le AT, Kako S, Butaney M, Ercan D, Mahale S, Davies KD, Aisner DL, Pilling AB, Berge EM, Kim J, Sasaki H, Park SI, Kryukov G, Garraway LA, Hammerman PS, Haas J, Andrews SW, Lipson D, Stephens PJ, Miller VA, Varella-Garcia M, Janne PA and Doebele RC.
Journal Nat. Med. 19 (11), 1469-1472 (2013)
Title Increased circulating levels of neurotrophins and elevated expression of their high-affinity receptors on skin and gut mast cells in mastocytosis .
Author Peng WM, Maintz L, Allam JP, Raap U, Gutgemann I, Kirfel J, Wardelmann E, Perner S, Zhao W, Fimmers R, Walgenbach K, Oldenburg J, Schwartz LB and Novak N.
Journal Blood 122 (10), 1779-1788 (2013)
Title TrkAIII promotes microtubule nucleation and assembly at the centrosome in SH-SY5Y neuroblastoma cells, contributing to an undifferentiated anaplastic phenotype .
Author Farina AR, Di Ianni N, Cappabianca L, Ruggeri P, Ragone M, Ianni G, Gulino A and Mackay AR.
Journal Biomed Res Int 2013, 740187 (2013)
Title Congenital Insensitivity to Pain with Anhidrosis .
Author Indo,Y.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title NGF and other growth factors induce an association between ERK1 and the NGF receptor, gp140prototrk .
Author Loeb DM, Tsao H, Cobb MH and Greene LA.
Journal Neuron 9 (6), 1053-1065 (1992)
Title TRK-T1 is a novel oncogene formed by the fusion of TPR and TRK genes in human papillary thyroid carcinomas .
Author Greco A, Pierotti MA, Bongarzone I, Pagliardini S, Lanzi C and Della Porta G.
Journal Oncogene 7 (2), 237-242 (1992)
Title A novel modular mosaic of cell adhesion motifs in the extracellular domains of the neurogenic trk and trkB tyrosine kinase receptors .
Author Schneider R and Schweiger M.
Journal Oncogene 6 (10), 1807-1811 (1991)
Title Human trk oncogenes activated by point mutation, in-frame deletion, and duplication of the tyrosine kinase domain .
Author Coulier F, Kumar R, Ernst M, Klein R, Martin-Zanca D and Barbacid M.
Journal Mol. Cell. Biol. 10 (8), 4202-4210 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.