• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001007792 Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3, mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_001007792.1, 56118209
Length 2581 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3, mRNA.
Product high affinity nerve growth factor receptor isoform 3
Comment

Summary: This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (3) utilizes alternate 5' exons and lacks an internal in-frame exon, compared to variant 2. Translation initiation occurs at an upstream AUG, resulting in a shorter isoform (3) with a unique N-terminus compared to isoform 2.

RefSeq NP_001007793.1
CDS 81..2363
Misc Feature(1)54..56
Misc Feature(2)282..440
Misc Feature(3)282..440
Misc Feature(4)432..560
Misc Feature(5)573..836
Misc Feature(6)582..836
Misc Feature(7)831..836
Misc Feature(8)885..1127
Misc Feature(9)912..914
Misc Feature(10)order(987..989,1035..1040,1047..1049)
Misc Feature(11)1458..1460
Misc Feature(12)1482..2321
Misc Feature(13)1500..2315
Misc Feature(14)order(1518..1532,1542..1544,1596..1598,1602..1604,
Misc Feature(15)order(1518..1523,1527..1532,1542..1544,1596..1598,
Misc Feature(16)order(1920..1922,1932..1934,2028..2042,2067..2069,
Misc Feature(17)1971..2048
Misc Feature(18)1998..2000
Misc Feature(19)2010..2012
Misc Feature(20)2013..2015
Misc Feature(21)2241..2243
Misc Feature(22)2343..2345
Exon (1)1..89
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (2)90..202
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (3)203..277
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (4)278..349
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (5)350..418
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (6)419..564
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (7)565..707
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (8)708..840
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (9)841..1167
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (10)1168..1223
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (11)1224..1326
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (12)1327..1473
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (13)1474..1604
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (14)1605..1777
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (15)1778..2018
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (16)2019..2177
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Exon (17)2178..2571
Gene:NTRK1
Gene Synonym:MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Translation MKEAALICLAPSVPPILTVKSWDTMQLRAARSRCTNLLAASYIENQQHLQHLELRDLRGL GELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPL HCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDD VLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAEND VGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFT EFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDP IPDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVL APEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWEL GEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFF GVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAA GMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPP ESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEV YAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
3+dbSNP:
3+a, gdbSNP:200011053
4+, cdbSNP:146775862
72+a, gdbSNP:200646544
76+c, tdbSNP:1800601
91+dbSNP:
91+c, gdbSNP:148424816
104+c, tdbSNP:139555558
113+a, cdbSNP:145596747
118+c, tdbSNP:199647144
126+a, tdbSNP:147703846
226+dbSNP:
226+a, tdbSNP:139140006
229+a, gdbSNP:55891455
244+c, tdbSNP:79678945
255+a, gdbSNP:2274496
261+c, gdbSNP:149646444
269+a, gdbSNP:147983523
285+dbSNP:
285+a, gdbSNP:201509045
305+c, tdbSNP:6340
316+a, gdbSNP:141592864
331+c, gdbSNP:202161010
332+a, tdbSNP:143410959
347+c, tdbSNP:149960336
363+dbSNP:
363+, adbSNP:66574101
371+a, gdbSNP:200417700
427+dbSNP:
427+c, tdbSNP:41267427
436+a, cdbSNP:144609655
459+c, tdbSNP:141629165
460+a, gdbSNP:141021604
472+a, gdbSNP:150271893
481+a, gdbSNP:199628251
494+c, tdbSNP:144594313
499+c, tdbSNP:201503610
501+a, cdbSNP:200655463
512+g, tdbSNP:199719847
555+a, gdbSNP:200167354
560+c, gdbSNP:138608619
565+dbSNP:
565+c, gdbSNP:201185829
575+a, gdbSNP:182531655
592+a, cdbSNP:146201511
601+c, tdbSNP:148324672
602+a, gdbSNP:114320051
605+c, tdbSNP:41443444
620+c, tdbSNP:147882947
621+a, gdbSNP:201192875
631+a, gdbSNP:200132482
644..645+, gdbSNP:68115560
648+c, tdbSNP:202030811
700+c, tdbSNP:55909005
703+g, tdbSNP:56000394
704+c, tdbSNP:41478354
768+dbSNP:
768+a, gdbSNP:35116695
777+a, gdbSNP:201509717
782+a, gdbSNP:201110800
786+c, tdbSNP:199800193
798+a, gdbSNP:145222195
803+g, tdbSNP:149204161
807+c, tdbSNP:151334385
808+a, gdbSNP:200305545
814+a, cdbSNP:138533001
844+c, tdbSNP:141483265
855+a, cdbSNP:137979116
917+a, gdbSNP:144015813
930+c, tdbSNP:137994522
1011+a, gdbSNP:139875058
1027+c, tdbSNP:150651692
1050+a, gdbSNP:201035170
1058+c, tdbSNP:145823996
1066+a, gdbSNP:121964869
1070+a, gdbSNP:2274498
1129+a, gdbSNP:140644885
1151+c, tdbSNP:146635274
1154..1155+, gdbSNP:142158754
1208+dbSNP:
1208+c, tdbSNP:147438950
1209+c, gdbSNP:199826686
1254+dbSNP:
1254+g, tdbSNP:142779943
1281+c, tdbSNP:17425856
1285+a, tdbSNP:191958638
1292+c, gdbSNP:147443162
1303+a, gdbSNP:56320207
1307+a, gdbSNP:41421749
1314+c, tdbSNP:150839958
1316+c, tdbSNP:55634591
1326+c, tdbSNP:34900547
1330+dbSNP:
1330+c, tdbSNP:202108805
1331+a, gdbSNP:200937156
1410+a, gdbSNP:139731614
1437+c, tdbSNP:141404661
1446+a, gdbSNP:144901788
1494+dbSNP:
1494+a, cdbSNP:200575096
1520..1521+, gdbSNP:67605263
1568+c, tdbSNP:200301690
1569+c, tdbSNP:149022780
1632+dbSNP:
1632+, cdbSNP:80356675
1633..1634+, gdbSNP:66550533
1646+a, gdbSNP:6334
1648+a, gdbSNP:201564883
1650+a, gdbSNP:41325044
1669+c, tdbSNP:55892037
1700+c, tdbSNP:6335
1701+c, gdbSNP:121964866
1713+a, gdbSNP:150579345
1715+a, c, gdbSNP:138423540
1721..1722+, ccdbSNP:200008715
1731+a, gdbSNP:121964870
1772+c, tdbSNP:139606876
1775+c, gdbSNP:146129485
1780+dbSNP:
1780+c, gdbSNP:188270548
1782+c, tdbSNP:6336
1786+c, tdbSNP:41470746
1810+g, tdbSNP:6339
1814+g, tdbSNP:41377846
1815+c, gdbSNP:149663928
1829+a, cdbSNP:141400005
1832..1833+, tdbSNP:80356676
1832+c, tdbSNP:6338
1836+c, tdbSNP:41327750
1844..1845+, gdbSNP:67310102
1859+c, tdbSNP:6337
1863+c, tdbSNP:41489348
1874+c, tdbSNP:148270992
1880+a, gdbSNP:17838192
1884+c, tdbSNP:201002156
1890+c, tdbSNP:121964867
1892+, cdbSNP:66774575
1911+g, tdbSNP:142870382
1948+c, gdbSNP:201211571
1979+c, tdbSNP:146079821
1992+g, tdbSNP:80356677
2020+dbSNP:
2020+g, tdbSNP:199905593
2024+c, tdbSNP:34271945
2028+a, gdbSNP:41358549
2042+c, gdbSNP:55970329
2056+c, tdbSNP:121964868
2060+c, tdbSNP:56008523
2077+g, tdbSNP:200022271
2085+a, tdbSNP:200935209
2111+c, tdbSNP:147776488
2114+c, tdbSNP:145139769
2141+c, tdbSNP:140852621
2151..2152+, cdbSNP:66859907
2171+c, tdbSNP:145656213
2174+a, gdbSNP:55668752
2194+dbSNP:
2194+c, tdbSNP:145081333
2243+c, tdbSNP:141540032
2244+a, gdbSNP:62640939
2249+a, gdbSNP:41436146
2254+a, gdbSNP:201891311
2311+a, c, gdbSNP:35669708
2334+c, tdbSNP:145023447
2340+a, gdbSNP:55948542
2370+g, tdbSNP:145060242
2372+, cdbSNP:67875082
2375+g, tdbSNP:41504244
2394+a, gdbSNP:876359
2412+c, gdbSNP:149115325
2494+a, gdbSNP:141728717
Gene SymbolNTRK1
Gene SynonymMTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Chromosome1
Locus Map1q21-q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001007792 Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3, mRNA. In-stock $639.00 $590.00 15
NM_001012331 Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1, mRNA. On-demand $899.00 20
NM_002529 Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 2, mRNA. On-demand $899.00 20
Title Assessing the range of kinase autoinhibition mechanisms in the insulin receptor family .
Author Artim,S.C., Mendrola,J.M. and Lemmon,M.A.
Journal Biochem. J. 448 (2), 213-220 (2012)
Title The crystal structures of TrkA and TrkB suggest key regions for achieving selective inhibition .
Author Bertrand,T., Kothe,M., Liu,J., Dupuy,A., Rak,A., Berne,P.F., Davis,S., Gladysheva,T., Valtre,C., Crenne,J.Y. and Mathieu,M.
Journal J. Mol. Biol. 423 (3), 439-453 (2012)
Title STK25 protein mediates TrkA and CCM2 protein-dependent death in pediatric tumor cells of neural origin .
Author Costa,B., Kean,M.J., Ast,V., Knight,J.D., Mett,A., Levy,Z., Ceccarelli,D.F., Badillo,B.G., Eils,R., Konig,R., Gingras,A.C. and Fainzilber,M.
Journal J. Biol. Chem. 287 (35), 29285-29289 (2012)
Title [Influence of gonadotropin releasing hormone agonist on the expression of mRNA of nerve growth factor and its receptors in eutopic endometrial stromal cells] .
Author Li,X.Y., Leng,J.H. and Lang,J.H.
Journal Zhonghua Fu Chan Ke Za Zhi 47 (6), 440-444 (2012)
Title Novel nonsense and frameshift NTRK1 gene mutations in Chinese patients with congenital insensitivity to pain with anhidrosis .
Author Li,M., Liang,J.Y., Sun,Z.H., Zhang,H. and Yao,Z.R.
Journal Genet. Mol. Res. 11 (3), 2156-2162 (2012)
Title NGF and other growth factors induce an association between ERK1 and the NGF receptor, gp140prototrk .
Author Loeb,D.M., Tsao,H., Cobb,M.H. and Greene,L.A.
Journal Neuron 9 (6), 1053-1065 (1992)
Title TRK-T1 is a novel oncogene formed by the fusion of TPR and TRK genes in human papillary thyroid carcinomas .
Author Greco,A., Pierotti,M.A., Bongarzone,I., Pagliardini,S., Lanzi,C. and Della Porta,G.
Journal Oncogene 7 (2), 237-242 (1992)
Title A novel modular mosaic of cell adhesion motifs in the extracellular domains of the neurogenic trk and trkB tyrosine kinase receptors .
Author Schneider,R. and Schweiger,M.
Journal Oncogene 6 (10), 1807-1811 (1991)
Title Tyrosine phosphorylation and tyrosine kinase activity of the trk proto-oncogene product induced by NGF .
Author Kaplan,D.R., Martin-Zanca,D. and Parada,L.F.
Journal Nature 350 (6314), 158-160 (1991)
Title Human trk oncogenes activated by point mutation, in-frame deletion, and duplication of the tyrosine kinase domain .
Author Coulier,F., Kumar,R., Ernst,M., Klein,R., Martin-Zanca,D. and Barbacid,M.
Journal Mol. Cell. Biol. 10 (8), 4202-4210 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.