• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens intestine-specific homeobox (ISX), mRNA.


RefSeq Accession Definition Services Price Order
NM_001008494 Homo sapiens intestine-specific homeobox (ISX), mRNA. ORF Sequence $214.02
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001008494.1, 57232758
Length 3401 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens intestine-specific homeobox (ISX), mRNA.
Product intestine-specific homeobox
Comment

Summary: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the RAXLX homeobox gene family. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: AK025181.1, AB219123.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025094 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_001008494.1
CDS 952..1689
Misc Feature(1)826..828
Misc Feature(2)1198..1374
Misc Feature(3)1198..1374
Misc Feature(4)order(1198..1212,1216..1218,1267..1269,1285..1287,
Misc Feature(5)order(1204..1206,1213..1215,1333..1335,1342..1347,
Exon (1)1..1180
Gene:ISX
Gene Synonym:Pix-1; RAXLX
Exon (2)1181..1332
Gene:ISX
Gene Synonym:Pix-1; RAXLX
Exon (3)1333..1449
Gene:ISX
Gene Synonym:Pix-1; RAXLX
Exon (4)1450..3383
Gene:ISX
Gene Synonym:Pix-1; RAXLX
Translation MCAEVGPALCRGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEA AASGSGLEKPPKDQPQEGRKSKRRVRTTFTTEQLHELEKIFHFTHYPDVHIRSQLAARIN LPEARVQIWFQNQRAKWRKQEKIGNLGAPQQLSEASVALPTNLDVAGPTWTSTALRRLAP PTSCCPSAQDQLASAWFPAWITLLPAHPWETQPVPGLPIHQTCIPVLCILPPPHPKWGSI CATST
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
7+dbSNP:
7+a, cdbSNP:150978788
120+a, gdbSNP:362150
137+c, tdbSNP:113980101
151+c, tdbSNP:184523171
236+a, gdbSNP:189089225
260+c, tdbSNP:140849535
400..401+, adbSNP:34727216
453+c, tdbSNP:75730376
520+c, tdbSNP:3810618
617+g, tdbSNP:112660672
657+c, tdbSNP:111427997
856+c, tdbSNP:77984721
923+a, cdbSNP:200664733
970+a, cdbSNP:138420595
974+c, tdbSNP:142905734
1023+a, gdbSNP:147323979
1033+c, tdbSNP:361863
1038+a, gdbSNP:181803035
1050+a, gdbSNP:361668
1055+c, tdbSNP:199562176
1067+a, gdbSNP:201193476
1086+c, tdbSNP:61739191
1096+c, tdbSNP:61739193
1120+a, gdbSNP:362090
1134+a, gdbSNP:142318080
1144+c, tdbSNP:145306030
1186+dbSNP:
1186+a, tdbSNP:201102724
1188+a, gdbSNP:201559969
1199+a, gdbSNP:8140287
1208+a, gdbSNP:202000999
1220+c, tdbSNP:200321013
1236+c, tdbSNP:188488954
1250+c, tdbSNP:146866945
1256+a, tdbSNP:140554371
1262+c, tdbSNP:192929768
1284+c, tdbSNP:200644238
1285+c, tdbSNP:144398029
1286+a, gdbSNP:147806898
1314+c, tdbSNP:140599630
1315+c, gdbSNP:200067062
1352+dbSNP:
1352+a, gdbSNP:144899858
1357+a, tdbSNP:191515527
1364+a, gdbSNP:184840753
1379+c, tdbSNP:201106092
1424+c, tdbSNP:7291048
1429+c, tdbSNP:145896632
1458+dbSNP:
1458+a, gdbSNP:199896807
1464+a, cdbSNP:151122186
1496+c, tdbSNP:61735502
1508+c, tdbSNP:182078320
1511+c, tdbSNP:200292559
1512+g, tdbSNP:202084562
1543+c, tdbSNP:141032770
1567+a, gdbSNP:141371935
1663+g, tdbSNP:200613012
1664+g, tdbSNP:61735036
1714+a, gdbSNP:185116560
1779+c, tdbSNP:3810619
1823+c, tdbSNP:189872702
1912+a, gdbSNP:141018696
1996+g, tdbSNP:144831614
2013+c, tdbSNP:147940646
2014+a, gdbSNP:183126236
2117+a, gdbSNP:141223769
2150+a, gdbSNP:112374826
2188+a, gdbSNP:186450254
2300+g, tdbSNP:137886754
2427+g, tdbSNP:113248574
2586+c, tdbSNP:73410194
2614+a, cdbSNP:149036576
2747+a, gdbSNP:8142871
2772+a, gdbSNP:143172492
3025+g, tdbSNP:74597006
3094+g, tdbSNP:148274521
3159+a, gdbSNP:78515170
Gene SymbolISX
Gene SynonymPix-1; RAXLX
Chromosome22
Locus Map22q12.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001008494 Homo sapiens intestine-specific homeobox (ISX), mRNA. Full Length $1190.35
ORF Sequence $214.02
Title Proinflammatory homeobox gene, ISX, regulates tumor growth and survival in hepatocellular carcinoma .
Author Hsu,S.H., Wang,L.T., Lee,K.T., Chen,Y.L., Liu,K.Y., Suen,J.L., Chai,C.Y. and Wang,S.N.
Journal Cancer Res. 73 (2), 508-518 (2013)
Title Isx participates in the maintenance of vitamin A metabolism by regulation of beta-carotene 15,15'-monooxygenase (Bcmo1) expression .
Author Seino,Y., Miki,T., Kiyonari,H., Abe,T., Fujimoto,W., Kimura,K., Takeuchi,A., Takahashi,Y., Oiso,Y., Iwanaga,T. and Seino,S.
Journal J. Biol. Chem. 283 (8), 4905-4911 (2008)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878