Homo sapiens intestine-specific homeobox (ISX), mRNA.
| RefSeq Version | NM_001008494.1, 57232758 |
| Length | 3401 bp |
| Structure | linear |
| Update Date | 12-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens intestine-specific homeobox (ISX), mRNA. |
| Product | intestine-specific homeobox |
| Comment | Summary: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the RAXLX homeobox gene family. [provided by RefSeq]. COMPLETENESS: complete on the 3' end. |
| RefSeq | NP_001008494.1 |
| CDS | 952..1689 | Exon (1) | 1..1180 | Exon (2) | 1..1180 | Exon (3) | 1181..1332 | Exon (4) | 1333..1449 | Exon (5) | 1450..3383 |
| Translation | MCAEVGPALCRGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEA
AASGSGLEKPPKDQPQEGRKSKRRVRTTFTTEQLHELEKIFHFTHYPDVHIRSQLAARIN
LPEARVQIWFQNQRAKWRKQEKIGNLGAPQQLSEASVALPTNLDVAGPTWTSTALRRLAP
PTSCCPSAQDQLASAWFPAWITLLPAHPWETQPVPGLPIHQTCIPVLCILPPPHPKWGSI
CATST
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(120) | - | g, a | dbSNP:362150 |
| 137 | + | c, t | dbSNP:113980101 |
| 400..401 | + | , a | dbSNP:34727216 |
| 453 | + | c, t | dbSNP:75730376 |
| 520 | + | c, t | dbSNP:3810618 |
| 617 | + | g, t | dbSNP:112660672 |
| 657 | + | c, t | dbSNP:111427997 |
| 856 | + | c, t | dbSNP:77984721 |
| complement(1033) | - | t, c | dbSNP:361863 |
| complement(1050) | - | g, a | dbSNP:361668 |
| 1086 | + | c, t | dbSNP:61739191 |
| 1096 | + | c, t | dbSNP:61739193 |
| complement(1120) | - | g, a | dbSNP:362090 |
| 1199 | + | a, g | dbSNP:8140287 |
| 1424 | + | c, t | dbSNP:7291048 |
| 1496 | + | c, t | dbSNP:61735502 |
| 1664 | + | g, t | dbSNP:61735036 |
| 1779 | + | c, t | dbSNP:3810619 |
| 2150 | + | a, g | dbSNP:112374826 |
| 2427 | + | g, t | dbSNP:113248574 |
| 2586 | + | c, t | dbSNP:73410194 |
| 2747 | + | a, g | dbSNP:8142871 |
| 3025 | + | g, t | dbSNP:74597006 |
| 3159 | + | a, g | dbSNP:78515170 |
| Gene Symbol | ISX |
| Gene Synonym | DKFZp781N2395; MGC138417; Pix-1; RAXLX |
| Chromosome | 22 |
| Locus Map | 22q12.3 |
| All Transcripts | NM_001008494 |
| Title | Isx participates in the maintenance of vitamin A metabolism by regulation of beta-carotene 15,15'-monooxygenase (Bcmo1) expression . |
| Author | Seino,Y., Miki,T., Kiyonari,H., Abe,T., Fujimoto,W., Kimura,K., Takeuchi,A., Takahashi,Y., Oiso,Y., Iwanaga,T. and Seino,S. |
| Journal | J. Biol. Chem. 283 (8), 4905-4911 (2008) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |