Ovis aries stearoyl-CoA desaturase (delta-9-desaturase) (SCD), mRNA.
| RefSeq Version | NM_001009254.1, 57164288 |
| Length | 1954 bp |
| Structure | linear |
| Update Date | 13-MAR-2011 |
| Organism | Ovis aries (sheep) |
| Definition | Ovis aries stearoyl-CoA desaturase (delta-9-desaturase) (SCD), mRNA. |
| Product | acyl-CoA desaturase |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AJ001048.1. Sequence Note: This sequence has been modified as follows: removed 32 bp suspected to be vector contamination from the 3' end. |
| RefSeq | NP_001009254.1 |
| CDS | 197..1276 |
| Translation | MPAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPNYQ
DKEGPKPKLEYVWRNIILMGLLHLGALYGITLIPTCKIYTFLWVLFYYVISALGITAGVH
RLWSHRTYKARLPLRVFLIIANTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFS
HVGWLLVRKHPAVREKGATLDLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWGE
SFQNSLFFATFLRYAVVLNATWLVNSAAHMYGYRPYDKTINPRENILVSLGAVGEGFHNY
HHTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAVLGRMKRTGEESYKSG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Gene Symbol | SCD |
| Gene Synonym | SCD |
| Chromosome | |
| All Transcripts | NM_001009254 |
| Title | Detection of quantitative trait loci affecting the milk fatty acid profile on sheep chromosome 22: role of the stearoyl-CoA desaturase gene in Spanish Churra sheep . |
| Author | Garcia-Fernandez,M., Gutierrez-Gil,B., Garcia-Gamez,E., Sanchez,J.P. and Arranz,J.J. |
| Journal | J. Dairy Sci. 93 (1), 348-357 (2010) |
| Title | Gene expression profiling during increased fetal lung expansion identifies genes likely to regulate development of the distal airways . |
| Author | Sozo,F., Wallace,M.J., Zahra,V.A., Filby,C.E. and Hooper,S.B. |
| Journal | Physiol. Genomics 24 (2), 105-113 (2006) |
| Title | Stearoyl-CoA desaturase mRNA is transcribed from a single gene in the ovine genome . |
| Author | Ward,R.J., Travers,M.T., Richards,S.E., Vernon,R.G., Salter,A.M., Buttery,P.J. and Barber,M.C. |
| Journal | Biochim. Biophys. Acta 1391 (2), 145-156 (1998) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |