|
You are here:
Biology CRO for Drug Discovery » Molecular Biology Services » Custom ORF Cloning Services » ORF Detail
 |
Apis mellifera melittin (Melt), mRNA.
| RefSeq Version | NM_001011607.1, 58585153 |
| Length | 374 bp |
| Structure | linear |
| Update Date | 12-MAR-2011 |
| Organism | Apis mellifera (honey bee) |
| Definition | Apis mellifera melittin (Melt), mRNA. |
| Product | melittin precursor |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X02007.1. |
| RefSeq | NP_001011607.1 |
| CDS | 53..265 |
| Translation | MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALI
SWIKRKRQQG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Gene Symbol | Melt |
| Gene Synonym | Melt |
| Chromosome | LG4 |
| Locus Map | LG4 |
| All Transcripts | NM_001011607 |
| Title | Identification of a novel melittin isoform from Africanized Apis mellifera venom . |
| Author | Sciani,J.M., Marques-Porto,R., Lourenco Junior,A., Orsi Rde,O., Ferreira Junior,R.S., Barraviera,B. and Pimenta,D.C. |
| Journal | Peptides 31 (8), 1473-1479 (2010) |
| Title | Cardiovascular effects of centrally injected melittin in hemorrhaged hypotensive rats: the investigation of peripheral mechanisms . |
| Author | Yalcin,M. and Savci,V. |
| Journal | Neuropeptides 41 (6), 465-475 (2007) |
| Title | Apis mellifera venom and melittin block neither NF-kappa B-p50-DNA interactions nor the activation of NF-kappa B, instead they activate the transcription of proinflammatory genes and the release of reactive oxygen intermediates . |
| Author | Stuhlmeier,K.M. |
| Journal | J. Immunol. 179 (1), 655-664 (2007) |
| Title | Insights into social insects from the genome of the honeybee Apis mellifera . |
| Author | |
| Journal | Nature 443 (7114), 931-949 (2006) |
| Title | Influence of the lipid composition on the kinetics of concerted insertion and folding of melittin in bilayers . |
| Author | Constantinescu,I. and Lafleur,M. |
| Journal | Biochim. Biophys. Acta 1667 (1), 26-37 (2004) |
| Title | The actions of melittin on membranes . |
| Author | Dempsey,C.E. |
| Journal | Biochim. Biophys. Acta 1031 (2), 143-161 (1990) |
| Title | Nucleotide sequence of cloned cDNA coding for honeybee prepromelittin . |
| Author | Vlasak,R., Unger-Ullmann,C., Kreil,G. and Frischauf,A.M. |
| Journal | Eur. J. Biochem. 135 (1), 123-126 (1983) |
| Title | Isolation and structure of N 1 -formyl melittin . |
| Author | Lubke,K., Matthes,S. and Kloss,G. |
| Journal | Experientia 27 (7), 765-767 (1971) |
| Title | Haemolytic activity and action on the surface tension of aqueous solutions of synthetic melittins and their derivatives . |
| Author | Schroder,E., Lubke,K., Lehmann,M. and Beetz,I. |
| Journal | Experientia 27 (7), 764-765 (1971) |
| Title | [Sequence analysis of melittin from tryptic and peptic degradation products] . |
| Author | Habermann,E. and Jentsch,J. |
| Journal | Hoppe-Seyler's Z. Physiol. Chem. 348 (1), 37-50 (1967) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |