Apis mellifera apamin protein (Apamin), mRNA.
| RefSeq Version | NM_001011612.1, 58585165 |
| Length | 304 bp |
| Structure | linear |
| Update Date | 11-MAR-2011 |
| Organism | Apis mellifera (honey bee) |
| Definition | Apis mellifera apamin protein (Apamin), mRNA. |
| Product | apamin preproprotein |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from S78458.1. COMPLETENESS: complete on the 3' end. |
| RefSeq | NP_001011612.1 |
| CDS | 29..169 |
| Translation | MISMLRCIYLFLSVILITSYFVTPVMPCNCKAPETALCARRCQQHG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Gene Symbol | Apamin |
| Gene Synonym | Apamin |
| Chromosome | LG12 |
| Locus Map | LG12 |
| All Transcripts | NM_001011612 |
| Title | Insights into social insects from the genome of the honeybee Apis mellifera . |
| Author | |
| Journal | Nature 443 (7114), 931-949 (2006) |
| Title | The precursors of the bee venom constituents apamin and MCD peptide are encoded by two genes in tandem which share the same 3'-exon . |
| Author | Gmachl,M. and Kreil,G. |
| Journal | J. Biol. Chem. 270 (21), 12704-12708 (1995) |
| Title | Cooperative disulfide bond formation in apamin . |
| Author | Chau,M.H. and Nelson,J.W. |
| Journal | Biochemistry 31 (18), 4445-4450 (1992) |
| Title | [Spatial structure of apamin in solution] . |
| Author | Andrianov,A.M. and Akhrem,A.A. |
| Journal | Mol. Biol. (Mosk.) 25 (4), 937-945 (1991) |
| Title | Binding and toxicity of apamin. Characterization of the active site . |
| Author | Labbe-Jullie,C., Granier,C., Albericio,F., Defendini,M.L., Ceard,B., Rochat,H. and Van Rietschoten,J. |
| Journal | Eur. J. Biochem. 196 (3), 639-645 (1991) |
| Title | Solution structure of apamin determined by nuclear magnetic resonance and distance geometry . |
| Author | Pease,J.H. and Wemmer,D.E. |
| Journal | Biochemistry 27 (22), 8491-8498 (1988) |
| Title | [Sequence analysis of bee venom neurotoxin (apamine) from its tryptic and chymotryptic cleavage products] . |
| Author | Haux,P., Sawerthal,H. and Habermann,E. |
| Journal | Hoppe-Seyler's Z. Physiol. Chem. 348 (6), 737-738 (1967) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |