• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens arginine-fifty homeobox (ARGFX), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu29754 Homo sapiens arginine-fifty homeobox (ARGFX), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu29754C Homo sapiens arginine-fifty homeobox (ARGFX), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001012659.1, 61969665
Length 948 bp
Structure linear
Update Date 26-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens arginine-fifty homeobox (ARGFX), mRNA.
Product arginine-fifty homeobox
Comment

Summary: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the ARGFX homeobox gene family. [provided by RefSeq, Jul 2008].

RefSeq NP_001012677.1
CDS 96..1043
Misc Feature(1)78..80
Misc Feature(2)333..485
Misc Feature(3)333..485
Misc Feature(4)order(333..344,348..350,399..401,417..419,456..458,
Misc Feature(5)order(336..338,345..347,465..467,474..479)
Exon (1)1..83
Gene:ARGFX
Gene Synonym:ARGFX
Exon (2)84..198
Gene:ARGFX
Gene Synonym:ARGFX
Exon (3)199..315
Gene:ARGFX
Gene Synonym:ARGFX
Exon (4)316..464
Gene:ARGFX
Gene Synonym:ARGFX
Exon (5)465..5065
Gene:ARGFX
Gene Synonym:ARGFX
Translation MRNRMAPENPQPDPFINRNYSNMKVIPPQDPASPSFTLLSKLECSGTVSAYCSLNLPGST DPPTSASRVAATTAIRRRHKERTSFTHQQYEELEALFSQTMFPDRNLQEKLALRLDLPES TVKVWFRNRRFKLKKQQQQQSAKQRNQILPSKKNVPTSPRTSPSPYAFSPVISDFYSSLP SQPLDPSNWAWNSTFTESSTSDFQMQDTQWERLVASVPALYSDAYDIFQIIELYNLPDEN EISSSSFHCLYQYLSPTKYQVGGQGSSLSIFAGPAVGLSPAQTWPNMTSQAFEAYSLTDS LEFQKTSNMVDLGFL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
44+dbSNP:
44+a, gdbSNP:375210747
104+c, tdbSNP:200448128
129+c, tdbSNP:147644178
139+c, tdbSNP:202191342
149+a, gdbSNP:201721488
162+a, gdbSNP:147017228
163+g, tdbSNP:188489586
190+c, g, tdbSNP:201565904
196+c, gdbSNP:145075970
297+dbSNP:
297+c, tdbSNP:140537962
321+dbSNP:
321+c, tdbSNP:149102809
332+c, tdbSNP:201467868
339+c, tdbSNP:138183438
371+a, gdbSNP:199794514
372+a, cdbSNP:199578428
396+a, gdbSNP:201664081
430+a, cdbSNP:201114172
440+c, tdbSNP:148181426
447+c, tdbSNP:267599563
448+c, tdbSNP:267599564
449+a, gdbSNP:185718718
480+dbSNP:
480+c, tdbSNP:201405550
498+a, cdbSNP:199525328
507+a, cdbSNP:183447701
528+c, tdbSNP:141209862
529+a, gdbSNP:9813391
570+c, tdbSNP:202064163
572+c, tdbSNP:142123906
577+c, tdbSNP:146404354
584+c, tdbSNP:139420670
622+a, gdbSNP:149627701
638+c, tdbSNP:376913494
651+c, tdbSNP:144775023
657+a, gdbSNP:144237895
658+a, gdbSNP:148714358
659+c, tdbSNP:201079029
661+a, gdbSNP:144768421
668+a, gdbSNP:267599565
676+a, cdbSNP:200387142
682+c, tdbSNP:61750878
740+c, tdbSNP:139699736
742+c, tdbSNP:112431334
743+a, gdbSNP:145252171
821+a, tdbSNP:138917850
931+a, cdbSNP:192920748
958+a, c, tdbSNP:79657977
967+a, c, gdbSNP:199782325
972+a, gdbSNP:373740963
1020+a, tdbSNP:148566270
1022+c, gdbSNP:199657126
1223+a, gdbSNP:115045570
1241+g, tdbSNP:116595666
1271..1272+, cdbSNP:35191130
1397+a, gdbSNP:185446877
1439+c, tdbSNP:145628833
1539+a, gdbSNP:187960668
1819+a, gdbSNP:371788576
1921+a, gdbSNP:192964034
1982+a, gdbSNP:147748191
2036+a, gdbSNP:373874014
2076+c, tdbSNP:11711973
2092+a, gdbSNP:114502094
2189+c, tdbSNP:141916184
2325+g, tdbSNP:11712050
complement(2408..2409)-, atdbSNP:3044706
2408+a, tdbSNP:201864700
2409..2410+, tadbSNP:35713310
2409+a, tdbSNP:200632755
complement(2409)-, atdbSNP:397836465
2421..2422+, tadbSNP:397708087
2527..2528+, agdbSNP:200036693
2635+a, gdbSNP:374449236
2668..2669+, tdbSNP:36106917
2738+a, gdbSNP:144196638
2753+a, cdbSNP:12171301
2762+a, gdbSNP:111644352
2926..2931+, aaaaatdbSNP:201179558
2929..2930+, aadbSNP:57481564
2996+c, gdbSNP:184248326
3092+g, tdbSNP:1718353
3145+a, gdbSNP:188205049
3206+, adbSNP:34783142
3220+, adbSNP:397875505
3220+a, tdbSNP:61798088
3222+a, tdbSNP:61798089
3251+c, tdbSNP:201503811
3262+c, tdbSNP:6790254
3339+a, gdbSNP:147781703
3483+c, tdbSNP:140176733
3484+a, gdbSNP:374864009
3511+a, gdbSNP:192396038
complement(3631)-t, adbSNP:570735
complement(3634)-t, adbSNP:570732
3643+a, gdbSNP:184729641
3709+a, gdbSNP:188788703
3717+a, cdbSNP:150330332
3916..3917+, tdbSNP:11386339
3917..3918+, tdbSNP:397830159
3968+c, tdbSNP:199633068
4056+c, tdbSNP:7638024
4075..4076+, tdbSNP:35654921
4213+a, cdbSNP:80017115
4336+a, gdbSNP:181700331
4478+a, gdbSNP:149925874
4720+a, gdbSNP:6783657
complement(4946)-c, adbSNP:149089777
Gene SymbolARGFX
Gene SynonymARGFX
Chromosome3
Locus Map3q13.33
Title The origin and evolution of ARGFX homeobox loci in mammalian radiation .
Author Li G and Holland PW.
Journal BMC Evol. Biol. 10, 182 (2010)
Title Annotation, nomenclature and evolution of four novel homeobox genes expressed in the human germ line .
Author Booth HA and Holland PW.
Journal Gene 387 (1-2), 7-14 (2007)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.