• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001017963 Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_001017963.2, 153792589
Length 3887 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, mRNA.
Product heat shock protein HSP 90-alpha isoform 1
Comment

Summary: The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_001017963.2
CDS 346..2910
Misc Feature(1)250..252
Misc Feature(2)835..1281
Misc Feature(3)835..1281
Misc Feature(4)order(850..852,862..864,871..873,982..984,988..990,
Misc Feature(5)862..864
Misc Feature(6)order(994..996,1000..1002,1114..1116,1120..1122)
Misc Feature(7)1579..2907
Exon (1)1..500
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Exon (2)501..711
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Exon (3)712..873
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Exon (4)874..1240
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Exon (5)1241..1374
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Exon (6)1375..1692
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Exon (7)1693..1858
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Exon (8)1859..2049
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Exon (9)2050..2197
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Exon (10)2198..2466
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Exon (11)2467..2800
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Exon (12)2801..3884
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Translation MPPCSGGDGSTPPGPSLRDRDCPAQSAEYPRDRLDPRPGSPSEASSPPFLRSRAPVNWYQ EKAQVFLWHLMVSGSTTLLCLWKQPFHVSAFPVTASLAFRQSQGAGQHLYKDLQPFILLR LLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDK IRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAF MEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGE PMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEK EDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWT RNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKK NNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVK KCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLK DYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEG KTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCC IVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKS VKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPP LEGDDDTSRMEEVD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(1)-dbSNP:
complement(1)-g, cdbSNP:138455240
complement(63)-g, adbSNP:113602506
complement(175)-g, cdbSNP:116641992
complement(179)-t, cdbSNP:35538974
complement(299)-t, cdbSNP:201667486
complement(373)-c, adbSNP:200223984
complement(382)-g, adbSNP:201793224
complement(414)-g, adbSNP:199751875
complement(424)-t, cdbSNP:147532243
complement(439)-c, adbSNP:143344364
complement(445)-g, adbSNP:41285492
complement(480)-g, cdbSNP:146442044
complement(556)-dbSNP:
complement(556)-t, adbSNP:8005905
complement(563)-g, adbSNP:148100560
complement(627)-g, adbSNP:10873531
complement(628)-t, cdbSNP:148866840
complement(664)-g, adbSNP:61744640
complement(665)-g, adbSNP:35446359
complement(676)-t, gdbSNP:144882817
complement(743)-dbSNP:
complement(743)-g, adbSNP:141159161
complement(771)-t, c, adbSNP:11547538
complement(783)-t, cdbSNP:201407591
complement(792)-c, adbSNP:11547539
complement(836)-t, cdbSNP:56030286
complement(840)-g, adbSNP:116476189
complement(858)-g, adbSNP:143957536
complement(888)-dbSNP:
complement(888)-g, adbSNP:116285249
complement(930)-g, adbSNP:11547540
complement(966)-g, adbSNP:11547530
complement(976)-g, adbSNP:139051948
complement(1029)-g, adbSNP:151160600
complement(1101)-t, gdbSNP:11547537
complement(1171)-g, adbSNP:142131905
complement(1191)-g, adbSNP:148554342
complement(1193)-g, adbSNP:147522436
complement(1203)-g, adbSNP:115674612
complement(1229)-t, cdbSNP:115967466
complement(1248)-dbSNP:
complement(1248)-g, adbSNP:11547541
complement(1287)-t, gdbSNP:78712166
complement(1326)-t, cdbSNP:140980766
complement(1386)-dbSNP:
complement(1386)-t, cdbSNP:147326221
complement(1432..1434)-, tttdbSNP:3832931
complement(1441)-g, adbSNP:3208444
complement(1447)-g, adbSNP:3208445
complement(1448)-t, cdbSNP:55783428
complement(1466)-g, adbSNP:199903835
complement(1502)-c, adbSNP:11547519
complement(1519)-t, cdbSNP:138155299
complement(1547)-t, adbSNP:55793809
complement(1605)-g, adbSNP:141494680
complement(1614)-g, adbSNP:112394273
complement(1623)-g, adbSNP:138662440
complement(1627)-t, gdbSNP:115457506
complement(1632)-g, cdbSNP:144736763
complement(1638)-g, adbSNP:115513913
complement(1645)-t, cdbSNP:11547515
complement(1647)-g, adbSNP:115566847
complement(1653)-t, cdbSNP:190888868
complement(1686)-t, cdbSNP:115927657
complement(1755)-dbSNP:
complement(1755)-t, cdbSNP:11547518
complement(1770)-t, cdbSNP:187480597
complement(1791)-t, cdbSNP:4947
complement(1800)-t, cdbSNP:200965220
complement(1884)-dbSNP:
complement(1884)-t, cdbSNP:113508244
complement(1968)-t, cdbSNP:143611681
complement(1995)-t, cdbSNP:113261380
complement(2000)-t, cdbSNP:145475799
complement(2007)-c, adbSNP:190621788
complement(2009)-t, cdbSNP:201315295
complement(2097)-dbSNP:
complement(2097)-g, adbSNP:34913441
complement(2109)-g, adbSNP:140441571
complement(2112)-t, cdbSNP:114259343
complement(2139)-t, adbSNP:201371540
complement(2164)-t, cdbSNP:201678802
complement(2194)-t, cdbSNP:200648994
complement(2226)-dbSNP:
complement(2226)-t, cdbSNP:186149423
complement(2273)-t, c, adbSNP:11547543
complement(2333)-g, adbSNP:144774653
complement(2356)-g, adbSNP:140941217
complement(2376)-t, adbSNP:75630701
complement(2401)-t, cdbSNP:181509556
complement(2402)-t, cdbSNP:200169081
complement(2421)-t, cdbSNP:36078484
complement(2442)-g, c, adbSNP:141409138
complement(2451)-g, cdbSNP:148507974
complement(2468)-dbSNP:
complement(2468)-g, adbSNP:114789230
complement(2508)-t, adbSNP:191895590
complement(2545)-c, adbSNP:34644998
complement(2561)-t, adbSNP:11547512
complement(2586)-g, adbSNP:11547532
complement(2610)-g, cdbSNP:200207432
complement(2628)-g, adbSNP:113093780
complement(2635)-t, cdbSNP:149353604
complement(2676)-g, adbSNP:138842506
complement(2703)-t, cdbSNP:35598057
complement(2733)-t, cdbSNP:11547513
complement(2740)-t, gdbSNP:112366202
complement(2763)-t, cdbSNP:36025350
complement(2778)-g, adbSNP:114622252
complement(2790)-g, adbSNP:11547524
complement(2800)-t, cdbSNP:56205516
complement(2805)-dbSNP:
complement(2805)-g, adbSNP:140417925
complement(2808)-t, cdbSNP:11547523
complement(2880)-g, adbSNP:61999351
complement(2926)-g, adbSNP:202202735
complement(2933)-g, cdbSNP:143088106
complement(2951)-t, cdbSNP:112417493
complement(2953)-t, gdbSNP:35798224
complement(3032)-t, adbSNP:116145388
complement(3085)-t, adbSNP:186085934
complement(3120)-g, adbSNP:55980776
complement(3141)-c, adbSNP:149051840
complement(3143)-t, cdbSNP:146487565
complement(3185..3186)-, tgdbSNP:35997255
complement(3185)-t, gdbSNP:200220551
complement(3188..3189)-, ac, cadbSNP:113020563
complement(3188..3189)-, cadbSNP:72520876
complement(3189..3190)-, tgdbSNP:3831488
complement(3204)-g, cdbSNP:11547511
complement(3214)-t, cdbSNP:2298878
complement(3247)-t, gdbSNP:115690563
complement(3288)-g, adbSNP:182139510
complement(3293)-g, adbSNP:144076402
complement(3311)-t, cdbSNP:1058078
complement(3357)-t, cdbSNP:11547531
complement(3468)-t, cdbSNP:191117771
complement(3469)-t, adbSNP:186290063
complement(3471)-g, adbSNP:35754658
complement(3479)-t, cdbSNP:190137720
complement(3498)-g, adbSNP:11547545
complement(3561)-t, cdbSNP:149779281
complement(3586)-c, adbSNP:34287031
complement(3625..3628)-, agttdbSNP:34767631
complement(3654)-t, cdbSNP:115514898
complement(3723)-c, adbSNP:186947478
complement(3737)-g, adbSNP:181396530
complement(3741)-t, cdbSNP:1059623
complement(3756)-g, adbSNP:189791627
complement(3775)-g, cdbSNP:150605311
complement(3854)-t, cdbSNP:1059629
complement(3867)-g, cdbSNP:184420805
complement(3874)-g, adbSNP:139925232
Gene SymbolHSP90AA1
Gene SynonymEL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2
Chromosome14
Locus Map14q32.33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001017963 Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, mRNA. On-demand $899.00 20
NM_005348 Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 2, mRNA. On-demand $849.00 20
Title Hsp70/Hsp90 chaperone machinery is involved in the assembly of the purinosome .
Author French,J.B., Zhao,H., An,S., Niessen,S., Deng,Y., Cravatt,B.F. and Benkovic,S.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (7), 2528-2533 (2013)
Title HSP90, HSPA8, HIF-1 alpha and HSP70-2 polymorphisms in breast cancer: a case-control study .
Author Zagouri,F., Sergentanis,T.N., Gazouli,M., Tsigginou,A., Dimitrakakis,C., Papaspyrou,I., Eleutherakis-Papaiakovou,E., Chrysikos,D., Theodoropoulos,G., Zografos,G.C., Antsaklis,A., Dimopoulos,A.M. and Papadimitriou,C.A.
Journal Mol. Biol. Rep. 39 (12), 10873-10879 (2012)
Title Opposing actions of heat shock protein 90 and 70 regulate nicotinamide adenine dinucleotide phosphate oxidase stability and reactive oxygen species production .
Author Chen,F., Yu,Y., Qian,J., Wang,Y., Cheng,B., Dimitropoulou,C., Patel,V., Chadli,A., Rudic,R.D., Stepp,D.W., Catravas,J.D. and Fulton,D.J.
Journal Arterioscler. Thromb. Vasc. Biol. 32 (12), 2989-2999 (2012)
Title Heat Shock Protein 90 is overexpressed in high-risk myelodysplastic syndromes and associated with higher expression and activation of Focal Adhesion Kinase .
Author Flandrin-Gresta,P., Solly,F., Aanei,C.M., Cornillon,J., Tavernier,E., Nadal,N., Morteux,F., Guyotat,D., Wattel,E. and Campos,L.
Journal Oncotarget 3 (10), 1158-1168 (2012)
Title A heat-shock protein axis regulates VEGFR2 proteolysis, blood vessel development and repair .
Author Bruns,A.F., Yuldasheva,N., Latham,A.M., Bao,L., Pellet-Many,C., Frankel,P., Stephen,S.L., Howell,G.J., Wheatcroft,S.B., Kearney,M.T., Zachary,I.C. and Ponnambalam,S.
Journal PLoS ONE 7 (11), E48539 (2012)
Title Conformational activation of a basic helix-loop-helix protein (MyoD1) by the C-terminal region of murine HSP90 (HSP84) .
Author Shaknovich,R., Shue,G. and Kohtz,D.S.
Journal Mol. Cell. Biol. 12 (11), 5059-5068 (1992)
Title Association of the 90-kDa heat shock protein does not affect the ligand-binding ability of androgen receptor .
Author Nemoto,T., Ohara-Nemoto,Y. and Ota,M.
Journal J. Steroid Biochem. Mol. Biol. 42 (8), 803-812 (1992)
Title Reconstitution of the multiprotein complex of pp60src, hsp90, and p50 in a cell-free system .
Author Hutchison,K.A., Brott,B.K., De Leon,J.H., Perdew,G.H., Jove,R. and Pratt,W.B.
Journal J. Biol. Chem. 267 (5), 2902-2908 (1992)
Title Mapping of the gene family for human heat-shock protein 90 alpha to chromosomes 1, 4, 11, and 14 .
Author Ozawa,K., Murakami,Y., Eki,T., Soeda,E. and Yokoyama,K.
Journal Genomics 12 (2), 214-220 (1992)
Title Molecular cloning of cDNA encoding a human heat-shock protein whose expression is induced by adenovirus type 12 E1A in HeLa cells .
Author Yamazaki,M., Tashiro,H., Yokoyama,K. and Soeda,E.
Journal Agric. Biol. Chem. 54 (12), 3163-3170 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.