• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001017963 Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_001017963.2, 153792589
Length 3887 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, mRNA.
Product heat shock protein HSP 90-alpha isoform 1
Comment

Summary: The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_001017963.2
CDS 346..2910
Misc Feature(1)250..252
Misc Feature(2)763..2907
Misc Feature(3)763..2907
Misc Feature(4)835..1281
Misc Feature(5)order(850..852,862..864,871..873,982..984,988..990,
Misc Feature(6)862..864
Misc Feature(7)order(994..996,1000..1002,1114..1116,1120..1122)
Misc Feature(8)1297..2907
Exon (1)1..500
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Exon (2)501..711
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Exon (3)712..873
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Exon (4)874..1240
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Exon (5)1241..1374
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Exon (6)1375..1692
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Exon (7)1693..1858
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Exon (8)1859..2049
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Exon (9)2050..2197
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Exon (10)2198..2466
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Exon (11)2467..2800
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Exon (12)2801..3884
Gene:HSP90AA1
Gene Synonym:EL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Translation MPPCSGGDGSTPPGPSLRDRDCPAQSAEYPRDRLDPRPGSPSEASSPPFLRSRAPVNWYQ EKAQVFLWHLMVSGSTTLLCLWKQPFHVSAFPVTASLAFRQSQGAGQHLYKDLQPFILLR LLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDK IRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAF MEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGE PMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEK EDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWT RNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKK NNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVK KCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLK DYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEG KTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCC IVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKS VKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPP LEGDDDTSRMEEVD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(1)-dbSNP:
complement(1)-g, cdbSNP:138455240
complement(12)-g, adbSNP:376176088
complement(63)-g, adbSNP:113602506
complement(127)-t, cdbSNP:375429292
complement(175)-g, cdbSNP:116641992
179+c, tdbSNP:35538974
complement(283)-t, cdbSNP:375206321
complement(299)-t, cdbSNP:201667486
complement(373)-c, adbSNP:200223984
complement(382)-g, adbSNP:201793224
complement(414)-g, adbSNP:199751875
complement(424)-t, cdbSNP:147532243
complement(436)-g, adbSNP:370815348
complement(439)-c, adbSNP:143344364
complement(443)-g, cdbSNP:369605823
complement(445)-g, adbSNP:41285492
complement(460)-t, cdbSNP:377542642
complement(480)-g, cdbSNP:146442044
complement(545)-dbSNP:
complement(545)-g, adbSNP:375034320
complement(556)-t, adbSNP:8005905
complement(563)-g, adbSNP:148100560
complement(568)-c, adbSNP:374711937
complement(591)-t, cdbSNP:371310259
complement(627)-g, adbSNP:10873531
complement(628)-t, cdbSNP:148866840
complement(664)-g, adbSNP:61744640
complement(665)-g, adbSNP:35446359
complement(676)-t, gdbSNP:144882817
complement(728)-dbSNP:
complement(728)-t, cdbSNP:372390355
complement(743)-g, adbSNP:141159161
771+a, c, tdbSNP:11547538
complement(783)-t, cdbSNP:201407591
792+a, cdbSNP:11547539
complement(807)-t, cdbSNP:373810935
complement(836)-t, cdbSNP:56030286
complement(840)-g, adbSNP:116476189
complement(858)-g, adbSNP:143957536
complement(888)-dbSNP:
complement(888)-g, adbSNP:116285249
complement(900)-g, adbSNP:373573309
complement(926)-g, adbSNP:370038606
complement(927)-c, adbSNP:370479565
930+a, gdbSNP:11547540
complement(955)-g, adbSNP:377483777
966+a, gdbSNP:11547530
complement(976)-g, adbSNP:139051948
complement(980)-g, adbSNP:373298207
complement(985)-t, cdbSNP:368941346
complement(1011)-t, cdbSNP:374679946
complement(1029)-g, adbSNP:151160600
complement(1089)-t, cdbSNP:371668109
1101+g, tdbSNP:11547537
complement(1164)-t, gdbSNP:369394114
complement(1171)-g, adbSNP:142131905
complement(1191)-g, adbSNP:148554342
complement(1193)-g, adbSNP:147522436
complement(1203)-g, adbSNP:115674612
complement(1222)-t, cdbSNP:375703098
complement(1229)-t, cdbSNP:115967466
complement(1248)-dbSNP:
complement(1248)-g, adbSNP:11547541
complement(1287)-t, gdbSNP:78712166
complement(1326)-t, cdbSNP:140980766
complement(1368)-g, adbSNP:374393547
complement(1386)-dbSNP:
complement(1386)-t, cdbSNP:147326221
complement(1387)-g, adbSNP:372198780
complement(1432..1434)-, tttdbSNP:3832931
1441+a, gdbSNP:3208444
1447+a, gdbSNP:3208445
complement(1448)-t, cdbSNP:55783428
complement(1456)-t, cdbSNP:368691420
complement(1466)-g, adbSNP:199903835
1502+a, cdbSNP:11547519
complement(1509)-t, cdbSNP:375764613
complement(1519..1521)-, cttdbSNP:368821873
complement(1541)-t, cdbSNP:372518751
complement(1542)-t, cdbSNP:371838714
complement(1547)-t, adbSNP:55793809
complement(1566)-t, gdbSNP:369417801
complement(1578)-t, cdbSNP:368576869
complement(1605)-g, adbSNP:141494680
complement(1614)-g, adbSNP:112394273
complement(1623)-g, adbSNP:138662440
complement(1627)-t, gdbSNP:115457506
complement(1628)-t, gdbSNP:376171723
complement(1632)-g, cdbSNP:144736763
complement(1638)-g, adbSNP:115513913
1645+c, tdbSNP:11547515
complement(1647)-g, adbSNP:115566847
complement(1653)-t, cdbSNP:190888868
complement(1680)-g, adbSNP:372516174
complement(1686)-t, cdbSNP:115927657
complement(1734)-dbSNP:
complement(1734)-t, cdbSNP:374753558
complement(1740)-g, adbSNP:369191827
complement(1746)-t, cdbSNP:370412494
1755+c, tdbSNP:11547518
complement(1757)-c, adbSNP:368373235
complement(1770)-t, cdbSNP:187480597
1791+c, tdbSNP:4947
complement(1800)-t, cdbSNP:200965220
complement(1860)-dbSNP:
complement(1860)-g, adbSNP:373300685
complement(1882)-c, adbSNP:369181545
complement(1884)-t, cdbSNP:113508244
complement(1968)-t, cdbSNP:143611681
complement(1971)-g, adbSNP:376198010
complement(1994)-g, adbSNP:371263487
complement(1995)-t, cdbSNP:113261380
complement(1997)-t, cdbSNP:368978190
complement(2000)-t, cdbSNP:145475799
complement(2007)-c, adbSNP:190621788
complement(2009)-t, cdbSNP:201315295
complement(2024)-t, adbSNP:375399671
complement(2067)-dbSNP:
complement(2067)-g, adbSNP:374792505
complement(2097)-g, adbSNP:34913441
complement(2109)-g, adbSNP:140441571
complement(2112)-t, cdbSNP:114259343
complement(2139)-t, adbSNP:201371540
complement(2154)-g, adbSNP:376081595
complement(2164)-t, cdbSNP:201678802
complement(2184)-g, adbSNP:373396614
complement(2194)-t, cdbSNP:200648994
complement(2226)-dbSNP:
complement(2226)-t, cdbSNP:186149423
complement(2248)-t, cdbSNP:377253279
complement(2270)-t, cdbSNP:372147275
2273+a, c, tdbSNP:11547543
complement(2333)-g, adbSNP:144774653
complement(2356)-g, adbSNP:140941217
complement(2376)-t, adbSNP:75630701
complement(2394)-t, cdbSNP:367761839
complement(2401)-t, cdbSNP:181509556
complement(2402)-t, cdbSNP:200169081
2421+c, tdbSNP:36078484
complement(2422)-g, adbSNP:372213976
complement(2442)-g, c, adbSNP:141409138
complement(2451)-g, cdbSNP:148507974
complement(2468)-dbSNP:
complement(2468)-g, adbSNP:114789230
complement(2508)-t, adbSNP:191895590
complement(2511)-g, adbSNP:375592323
complement(2545)-c, adbSNP:34644998
2561+a, tdbSNP:11547512
2586+a, gdbSNP:11547532
complement(2610)-g, cdbSNP:200207432
complement(2622)-g, adbSNP:370998676
complement(2628)-g, adbSNP:113093780
complement(2635)-t, cdbSNP:149353604
complement(2676)-g, adbSNP:138842506
complement(2694)-t, adbSNP:377067991
2703+c, tdbSNP:35598057
2733+c, tdbSNP:11547513
complement(2740)-t, gdbSNP:112366202
complement(2763)-t, cdbSNP:36025350
complement(2778)-g, adbSNP:114622252
2790+a, gdbSNP:11547524
complement(2800)-t, cdbSNP:56205516
complement(2805)-dbSNP:
complement(2805)-g, adbSNP:140417925
complement(2808)-t, cdbSNP:11547523
complement(2880)-g, adbSNP:61999351
complement(2926)-g, adbSNP:202202735
complement(2933)-g, cdbSNP:143088106
complement(2939)-t, gdbSNP:377540509
complement(2951)-t, cdbSNP:112417493
complement(2953)-t, gdbSNP:35798224
complement(2982)-g, adbSNP:373854012
complement(3032)-t, adbSNP:116145388
complement(3085)-t, adbSNP:186085934
complement(3110..3111)-, adbSNP:375238976
complement(3120)-g, adbSNP:55980776
complement(3124)-t, cdbSNP:369711643
complement(3141)-c, adbSNP:149051840
complement(3143)-t, cdbSNP:146487565
complement(3153)-t, gdbSNP:375492660
complement(3185..3186)-, cadbSNP:397717863
complement(3185)-t, gdbSNP:200220551
complement(3186..3187)-, cadbSNP:397773688
complement(3188..3189)-, ac, cadbSNP:72520876
complement(3189..3190)-, tgdbSNP:3831488
3204+c, gdbSNP:11547511
3214+c, tdbSNP:2298878
complement(3247)-t, gdbSNP:115690563
complement(3288)-g, adbSNP:182139510
3293+a, gdbSNP:144076402
3311+c, tdbSNP:1058078
complement(3311)-g, adbSNP:112268853
complement(3357)-t, cdbSNP:11547531
complement(3468)-t, cdbSNP:191117771
complement(3469)-t, adbSNP:186290063
3471+a, gdbSNP:35754658
complement(3479)-t, cdbSNP:190137720
complement(3498)-g, adbSNP:11547545
complement(3561)-t, cdbSNP:149779281
complement(3586)-c, adbSNP:34287031
3625..3628+, agttdbSNP:34767631
complement(3628..3631)-, actadbSNP:368736722
complement(3654)-t, cdbSNP:115514898
complement(3723)-c, adbSNP:186947478
complement(3737)-g, adbSNP:181396530
3741+c, tdbSNP:1059623
complement(3756)-g, adbSNP:189791627
complement(3775)-g, cdbSNP:150605311
complement(3785)-t, cdbSNP:372342215
3854+c, tdbSNP:1059629
complement(3867)-g, cdbSNP:184420805
complement(3874)-g, adbSNP:139925232
complement(3879)-g, cdbSNP:376414746
Gene SymbolHSP90AA1
Gene SynonymEL52; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Chromosome14
Locus Map14q32.33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005348 Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 2, mRNA. On-demand $849.00 20
NM_001017963 Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, mRNA. On-demand $899.00 20
Title Increased expression of heat shock protein 90 in keratinocytes and mast cells in patients with psoriasis .
Author Kakeda M, Arock M, Schlapbach C and Yawalkar N.
Journal J. Am. Acad. Dermatol. 70 (4), 683-690 (2014)
Title Extracellular Hsp90 mediates an NF-kappaB dependent inflammatory stromal program: implications for the prostate tumor microenvironment .
Author Bohonowych JE, Hance MW, Nolan KD, Defee M, Parsons CH and Isaacs JS.
Journal Prostate 74 (4), 395-407 (2014)
Title Coordinated regulation of serum- and glucocorticoid-inducible kinase 3 by a C-terminal hydrophobic motif and Hsp90-Cdc37 chaperone complex .
Author Wang Y, Xu W, Zhou D, Neckers L and Chen S.
Journal J. Biol. Chem. 289 (8), 4815-4826 (2014)
Title The significance of HSP90AA1, HSP90AB1 and HSP90B1 gene polymorphisms in a Turkish population with non-small cell lung cancer .
Author Coskunpinar E, Akkaya N, Yildiz P, Oltulu YM, Aynaci E, Isbir T and Yaylim I.
Journal Anticancer Res. 34 (2), 753-757 (2014)
Title Regulatory role of the 90-kDa-heat-shock protein (Hsp90) and associated factors on gene expression .
Author Erlejman AG, Lagadari M, Toneatto J, Piwien-Pilipuk G and Galigniana MD.
Journal Biochim. Biophys. Acta 1839 (2), 71-87 (2014)
Title Conformational activation of a basic helix-loop-helix protein (MyoD1) by the C-terminal region of murine HSP90 (HSP84) .
Author Shaknovich R, Shue G and Kohtz DS.
Journal Mol. Cell. Biol. 12 (11), 5059-5068 (1992)
Title Association of the 90-kDa heat shock protein does not affect the ligand-binding ability of androgen receptor .
Author Nemoto T, Ohara-Nemoto Y and Ota M.
Journal J. Steroid Biochem. Mol. Biol. 42 (8), 803-812 (1992)
Title Reconstitution of the multiprotein complex of pp60src, hsp90, and p50 in a cell-free system .
Author Hutchison KA, Brott BK, De Leon JH, Perdew GH, Jove R and Pratt WB.
Journal J. Biol. Chem. 267 (5), 2902-2908 (1992)
Title Mapping of the gene family for human heat-shock protein 90 alpha to chromosomes 1, 4, 11, and 14 .
Author Ozawa K, Murakami Y, Eki T, Soeda E and Yokoyama K.
Journal Genomics 12 (2), 214-220 (1992)
Title Molecular cloning of cDNA encoding a human heat-shock protein whose expression is induced by adenovirus type 12 E1A in HeLa cells .
Author Yamazaki M, Tashiro H, Yokoyama K and Soeda E.
Journal Agric. Biol. Chem. 54 (12), 3163-3170 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.