Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, mRNA.
| RefSeq Version | NM_001017963.2, 153792589 |
| Length | 3887 bp |
| Structure | linear |
| Update Date | 10-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, mRNA. |
| Product | heat shock protein HSP 90-alpha isoform 1 |
| Comment | Summary: HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. There are 2 major cytosolic HSP90 proteins, HSP90AA1, an inducible form, and HSP90AB1 (MIM 140572), a constitutive form. Other HSP90 proteins are found in endoplasmic reticulum (HSP90B1; MIM 191175) and mitochondria (TRAP1; MIM 606219) (Chen et al., 2005 [PubMed 16269234]).[supplied by OMIM]. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1). |
| RefSeq | NP_001017963.2 |
| CDS | 346..2910 | Exon (1) | 1..500 | Exon (2) | 1..500 | Exon (3) | 501..711 | Exon (4) | 712..873 | Exon (5) | 874..1240 | Exon (6) | 1241..1374 | Exon (7) | 1375..1692 | Exon (8) | 1693..1858 | Exon (9) | 1859..2049 | Exon (10) | 2050..2197 | Exon (11) | 2198..2466 | Exon (12) | 2467..2800 | Exon (13) | 2801..3884 |
| Translation | MPPCSGGDGSTPPGPSLRDRDCPAQSAEYPRDRLDPRPGSPSEASSPPFLRSRAPVNWYQ
EKAQVFLWHLMVSGSTTLLCLWKQPFHVSAFPVTASLAFRQSQGAGQHLYKDLQPFILLR
LLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDK
IRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAF
MEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGE
PMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEK
EDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWT
RNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKK
NNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVK
KCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLK
DYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEG
KTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCC
IVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKS
VKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPP
LEGDDDTSRMEEVD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(63) | - | g, a | dbSNP:113602506 |
| complement(175) | - | g, c | dbSNP:116641992 |
| 179 | + | c, t | dbSNP:35538974 |
| complement(287) | - | g, c | dbSNP:78436885 |
| complement(445) | - | g, a | dbSNP:41285492 |
| complement(556) | - | t, a | dbSNP:8005905 |
| complement(627) | - | g, a | dbSNP:10873531 |
| complement(664) | - | g, a | dbSNP:61744640 |
| 665 | + | a, g | dbSNP:35446359 |
| 771 | + | a, c | dbSNP:11547538 |
| 792 | + | a, c | dbSNP:11547539 |
| complement(836) | - | t, c | dbSNP:56030286 |
| complement(840) | - | g, a | dbSNP:116476189 |
| 844 | + | c, t | dbSNP:11547522 |
| 872 | + | a, g | dbSNP:11547527 |
| complement(872) | - | t, c | dbSNP:112990598 |
| complement(888) | - | g, a | dbSNP:116285249 |
| 930 | + | a, g | dbSNP:11547540 |
| 966 | + | a, g | dbSNP:11547530 |
| 1101 | + | g, t | dbSNP:11547537 |
| complement(1203) | - | g, a | dbSNP:115674612 |
| complement(1229) | - | t, c | dbSNP:115967466 |
| complement(1248) | - | g, a | dbSNP:11547541 |
| complement(1287) | - | t, g | dbSNP:78712166 |
| 1289 | + | a, c | dbSNP:1801329 |
| complement(1432..1434) | - | , ttt | dbSNP:3832931 |
| 1441 | + | a, g | dbSNP:3208444 |
| 1447 | + | a, g | dbSNP:3208445 |
| complement(1448) | - | t, c | dbSNP:55783428 |
| 1502 | + | a, c | dbSNP:11547519 |
| complement(1547) | - | t, a | dbSNP:55793809 |
| complement(1614) | - | g, a | dbSNP:112394273 |
| complement(1627) | - | t, g | dbSNP:115457506 |
| complement(1638) | - | g, a | dbSNP:115513913 |
| 1645 | + | c, t | dbSNP:11547515 |
| complement(1647) | - | g, a | dbSNP:115566847 |
| complement(1686) | - | t, c | dbSNP:115927657 |
| 1705 | + | g, t | dbSNP:11547514 |
| 1755 | + | c, t | dbSNP:11547518 |
| 1791 | + | c, t | dbSNP:4947 |
| complement(1884) | - | t, c | dbSNP:113508244 |
| complement(1995) | - | t, c | dbSNP:113261380 |
| 2090 | + | c, t | dbSNP:11547529 |
| 2097 | + | a, g | dbSNP:34913441 |
| complement(2112) | - | t, c | dbSNP:114259343 |
| 2273 | + | a, t | dbSNP:11547543 |
| complement(2376) | - | t, a | dbSNP:75630701 |
| 2421 | + | c, t | dbSNP:36078484 |
| complement(2468) | - | g, a | dbSNP:114789230 |
| 2545 | + | a, c | dbSNP:34644998 |
| 2561 | + | a, t | dbSNP:11547512 |
| 2586 | + | a, g | dbSNP:11547532 |
| 2622 | + | a, c | dbSNP:61733529 |
| complement(2628) | - | g, a | dbSNP:113093780 |
| 2703 | + | c, t | dbSNP:35598057 |
| 2733 | + | c, t | dbSNP:11547513 |
| complement(2740) | - | t, g | dbSNP:112366202 |
| 2763 | + | c, t | dbSNP:36025350 |
| 2764 | + | g, t | dbSNP:11547536 |
| complement(2778) | - | g, a | dbSNP:114622252 |
| 2790 | + | a, g | dbSNP:11547524 |
| complement(2800) | - | t, c | dbSNP:56205516 |
| 2808 | + | c, t | dbSNP:11547523 |
| complement(2880) | - | g, a | dbSNP:61999351 |
| complement(2951) | - | t, c | dbSNP:112417493 |
| 2953 | + | g, t | dbSNP:35798224 |
| complement(3032) | - | t, a | dbSNP:116145388 |
| 3050 | + | c, t | dbSNP:1802096 |
| complement(3120) | - | g, a | dbSNP:55980776 |
| 3185..3186 | + | , tg | dbSNP:35997255 |
| complement(3186..3187) | - | , ca | dbSNP:72520876 |
| complement(3188..3189) | - | , ac | dbSNP:113020563 |
| 3189..3190 | + | , tg | dbSNP:3831488 |
| 3204 | + | c, g | dbSNP:11547511 |
| 3214 | + | c, t | dbSNP:2298878 |
| complement(3247) | - | t, g | dbSNP:115690563 |
| complement(3311) | - | g, a | dbSNP:112268853 |
| 3311 | + | c, t | dbSNP:1058078 |
| 3357 | + | c, t | dbSNP:11547531 |
| 3471 | + | a, g | dbSNP:35754658 |
| complement(3498) | - | g, a | dbSNP:11547545 |
| 3586 | + | a, c | dbSNP:34287031 |
| 3625..3628 | + | , agtt | dbSNP:34767631 |
| complement(3654) | - | t, c | dbSNP:115514898 |
| 3741 | + | c, t | dbSNP:1059623 |
| complement(3818) | - | g, a | dbSNP:114412854 |
| 3854 | + | c, t | dbSNP:1059629 |
| Gene Symbol | HSP90AA1 |
| Gene Synonym | FLJ31884; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP2 |
| Chromosome | 14 |
| Locus Map | 14q32.33 |
| All Transcripts | NM_001017963 , NM_005348 |
| Title | HSP90 is crucial for regulation of LAT expression in activated T cells . |
| Author | Hayashi,K. and Kamikawa,Y. |
| Journal | Mol. Immunol. 48 (6-7), 941-946 (2011) |
| Title | Heat shock protein 90 facilitates formation of the HBV capsid via interacting with the HBV core protein dimers . |
| Author | Shim,H.Y., Quan,X., Yi,Y.S. and Jung,G. |
| Journal | Virology 410 (1), 161-169 (2011) |
| Title | N-terminal domain of human Hsp90 triggers binding to the cochaperone p23 . |
| Author | Karagoz,G.E., Duarte,A.M., Ippel,H., Uetrecht,C., Sinnige,T., van Rosmalen,M., Hausmann,J., Heck,A.J., Boelens,R. and Rudiger,S.G. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 108 (2), 580-585 (2011) |
| Title | Gyrase B inhibitor impairs HIV-1 replication by targeting Hsp90 and the capsid protein . |
| Author | Vozzolo,L., Loh,B., Gane,P.J., Tribak,M., Zhou,L., Anderson,I., Nyakatura,E., Jenner,R.G., Selwood,D. and Fassati,A. |
| Journal | J. Biol. Chem. 285 (50), 39314-39328 (2010) |
| Title | Activating transcription factor-3 (ATF3) functions as a tumor suppressor in colon cancer and is up-regulated upon heat-shock protein 90 (Hsp90) inhibition . |
| Author | Hackl,C., Lang,S.A., Moser,C., Mori,A., Fichtner-Feigl,S., Hellerbrand,C., Dietmeier,W., Schlitt,H.J., Geissler,E.K. and Stoeltzing,O. |
| Journal | BMC Cancer 10, 668 (2010) |
| Title | Conformational activation of a basic helix-loop-helix protein (MyoD1) by the C-terminal region of murine HSP90 (HSP84) . |
| Author | Shaknovich,R., Shue,G. and Kohtz,D.S. |
| Journal | Mol. Cell. Biol. 12 (11), 5059-5068 (1992) |
| Title | Association of the 90-kDa heat shock protein does not affect the ligand-binding ability of androgen receptor . |
| Author | Nemoto,T., Ohara-Nemoto,Y. and Ota,M. |
| Journal | J. Steroid Biochem. Mol. Biol. 42 (8), 803-812 (1992) |
| Title | Reconstitution of the multiprotein complex of pp60src, hsp90, and p50 in a cell-free system . |
| Author | Hutchison,K.A., Brott,B.K., De Leon,J.H., Perdew,G.H., Jove,R. and Pratt,W.B. |
| Journal | J. Biol. Chem. 267 (5), 2902-2908 (1992) |
| Title | Mapping of the gene family for human heat-shock protein 90 alpha to chromosomes 1, 4, 11, and 14 . |
| Author | Ozawa,K., Murakami,Y., Eki,T., Soeda,E. and Yokoyama,K. |
| Journal | Genomics 12 (2), 214-220 (1992) |
| Title | Molecular cloning of cDNA encoding a human heat-shock protein whose expression is induced by adenovirus type 12 E1A in HeLa cells . |
| Author | Yamazaki,M., Tashiro,H., Yokoyama,K. and Soeda,E. |
| Journal | Agric. Biol. Chem. 54 (12), 3163-3170 (1990) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |