• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens retinoic acid receptor, alpha (RARA), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001024809 Homo sapiens retinoic acid receptor, alpha (RARA), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_001024809.3, 300388162
Length 3494 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens retinoic acid receptor, alpha (RARA), transcript variant 2, mRNA.
Product retinoic acid receptor alpha isoform 2
Comment

Summary: This gene represents a nuclear retinoic acid receptor. The encoded protein, retinoic acid receptor alpha, regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulopoeisis, and transcription of clock genes. Translocations between this locus and several other loci have been associated with acute promyelocytic leukemia. Alternatively spliced transcript variants have been found for this locus.[provided by RefSeq, Sep 2010].


Transcript Variant: This variant (2) reflects the use of an alternate promoter and has a distinct 5' exon, compared to transcript variant 1. Translation is predicted to initiate from this alternate exon, and the resulting protein (isoform 2) has a shorter and a distinct N-terminus compared to isoform 1.

RefSeq NP_001019980.1
CDS 687..2060
Misc Feature(1)630..632
Misc Feature(2)915..1169
Misc Feature(3)915..1169
Misc Feature(4)order(933..935,942..944,984..986,993..995,1041..1043,
Misc Feature(5)order(963..971,987..992,996..998,1002..1004,1008..1013,
Misc Feature(6)order(1074..1076,1083..1094)
Misc Feature(7)1227..1919
Misc Feature(8)order(1353..1355,1362..1367,1374..1376,1467..1469,
Misc Feature(9)order(1389..1391,1401..1403,1431..1433,1440..1445,
Misc Feature(10)order(1614..1616,1680..1685,1716..1718,1725..1730,
Exon (1)1..849
Gene:RARA
Gene Synonym:NR1B1; RAR
Exon (2)850..998
Gene:RARA
Gene Synonym:NR1B1; RAR
Exon (3)999..1140
Gene:RARA
Gene Synonym:NR1B1; RAR
Exon (4)1141..1301
Gene:RARA
Gene Synonym:NR1B1; RAR
Exon (5)1302..1478
Gene:RARA
Gene Synonym:NR1B1; RAR
Exon (6)1479..1683
Gene:RARA
Gene Synonym:NR1B1; RAR
Exon (7)1684..1842
Gene:RARA
Gene Synonym:NR1B1; RAR
Exon (8)1843..3477
Gene:RARA
Gene Synonym:NR1B1; RAR
Translation MYESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIETQS SSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCH RDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVG ELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQ LPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPL TDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRK RRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSG QPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
359+dbSNP:
359+a, gdbSNP:112359597
458+a, cdbSNP:181948756
705+g, tdbSNP:149514124
813+c, tdbSNP:202229958
818+c, gdbSNP:185276091
902+dbSNP:
902+a, gdbSNP:2229771
980+c, tdbSNP:148477186
1169+dbSNP:
1169+a, gdbSNP:142718201
1217+a, gdbSNP:200393055
1228+a, gdbSNP:79997555
1231+c, tdbSNP:112626578
1253+c, gdbSNP:113014668
1344+dbSNP:
1344+c, tdbSNP:201919660
1397+c, tdbSNP:150816475
1412+c, tdbSNP:139260459
1414+a, gdbSNP:200827868
1430+a, cdbSNP:199944788
1436+c, tdbSNP:144249834
1475+c, tdbSNP:41283421
1508+dbSNP:
1508+c, tdbSNP:77633370
1577+c, tdbSNP:35163502
1607+c, tdbSNP:200326853
1624+c, gdbSNP:145829003
1640+g, tdbSNP:148999974
1658+c, tdbSNP:143827534
1661+c, tdbSNP:147971091
1700+dbSNP:
1700+a, gdbSNP:140714166
1706+a, c, gdbSNP:74349261
1710+a, cdbSNP:138717943
1745+a, gdbSNP:201508544
1757+c, tdbSNP:142769381
1850+dbSNP:
1850+a, gdbSNP:146977371
1984+, cdbSNP:5820346
1988+c, gdbSNP:4992440
2062+c, tdbSNP:2229773
2100+c, tdbSNP:143781383
2151+c, gdbSNP:2229772
2176+g, tdbSNP:11544351
2213+c, tdbSNP:139482076
2215+a, gdbSNP:190879195
2224+a, gdbSNP:183204850
2344+c, tdbSNP:149687193
2405+a, gdbSNP:115635151
2418+a, cdbSNP:117770216
2497+c, gdbSNP:200674161
2605+a, tdbSNP:185566558
2839+c, gdbSNP:190326404
3163+c, tdbSNP:115248059
3166+a, gdbSNP:74396306
3167+c, tdbSNP:182891484
3239+, cdbSNP:71355453
3406+a, gdbSNP:140111856
Gene SymbolRARA
Gene SynonymNR1B1; RAR
Chromosome17
Locus Map17q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000964 Homo sapiens retinoic acid receptor, alpha (RARA), transcript variant 1, mRNA. On-demand TBD TBD
NM_001024809 Homo sapiens retinoic acid receptor, alpha (RARA), transcript variant 2, mRNA. On-demand TBD TBD
NM_001145301 Homo sapiens retinoic acid receptor, alpha (RARA), transcript variant 3, mRNA. On-demand TBD TBD
NM_001145302 Homo sapiens retinoic acid receptor, alpha (RARA), transcript variant 4, mRNA. On-demand TBD TBD
Title Poly (ADP-ribose) glycohydrolase regulates retinoic acid receptor-mediated gene expression .
Author Le May,N., Iltis,I., Ame,J.C., Zhovmer,A., Biard,D., Egly,J.M., Schreiber,V. and Coin,F.
Journal Mol. Cell 48 (5), 785-798 (2012)
Title DICER- and AGO3-dependent generation of retinoic acid-induced DR2 Alu RNAs regulates human stem cell proliferation .
Author Hu,Q., Tanasa,B., Trabucchi,M., Li,W., Zhang,J., Ohgi,K.A., Rose,D.W., Glass,C.K. and Rosenfeld,M.G.
Journal Nat. Struct. Mol. Biol. 19 (11), 1168-1175 (2012)
Title The PRKAR1A gene is fused to RARA in a new variant acute promyelocytic leukemia .
Author Catalano,A., Dawson,M.A., Somana,K., Opat,S., Schwarer,A., Campbell,L.J. and Iland,H.
Journal Blood 110 (12), 4073-4076 (2007)
Title Fusion of retinoic acid receptor alpha to NuMA, the nuclear mitotic apparatus protein, by a variant translocation in acute promyelocytic leukaemia .
Author Wells,R.A., Catzavelos,C. and Kamel-Reid,S.
Journal Nat. Genet. 17 (1), 109-113 (1997)
Title PLZF-RAR alpha fusion proteins generated from the variant t(11;17)(q23;q21) translocation in acute promyelocytic leukemia inhibit ligand-dependent transactivation of wild-type retinoic acid receptors .
Author Chen,Z., Guidez,F., Rousselot,P., Agadir,A., Chen,S.J., Wang,Z.Y., Degos,L., Zelent,A., Waxman,S. and Chomienne,C.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (3), 1178-1182 (1994)
Title A transferable silencing domain is present in the thyroid hormone receptor, in the v-erbA oncogene product and in the retinoic acid receptor .
Author Baniahmad,A., Kohne,A.C. and Renkawitz,R.
Journal EMBO J. 11 (3), 1015-1023 (1992)
Title Structure, localization and transcriptional properties of two classes of retinoic acid receptor alpha fusion proteins in acute promyelocytic leukemia (APL): structural similarities with a new family of oncoproteins .
Author Kastner,P., Perez,A., Lutz,Y., Rochette-Egly,C., Gaub,M.P., Durand,B., Lanotte,M., Berger,R. and Chambon,P.
Journal EMBO J. 11 (2), 629-642 (1992)
Title Retinoid X receptor interacts with nuclear receptors in retinoic acid, thyroid hormone and vitamin D3 signalling .
Author Kliewer,S.A., Umesono,K., Mangelsdorf,D.J. and Evans,R.M.
Journal Nature 355 (6359), 446-449 (1992)
Title The PML-RAR alpha fusion mRNA generated by the t(15;17) translocation in acute promyelocytic leukemia encodes a functionally altered RAR .
Author de The,H., Lavau,C., Marchio,A., Chomienne,C., Degos,L. and Dejean,A.
Journal Cell 66 (4), 675-684 (1991)
Title Characterization of a functional promoter for the human retinoic acid receptor-alpha (hRAR-alpha) .
Author Brand,N.J., Petkovich,M. and Chambon,P.
Journal Nucleic Acids Res. 18 (23), 6799-6806 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.