• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_001024939 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA. ORF Sequence $435.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001024939.2, 190684652
Length 2348 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA.
Product solute carrier family 2, facilitated glucose transporter member 11 isoform b
Comment

Summary: SLC2A11 belongs to a family of plasma membrane proteins that mediate transport of sugars across the membrane by facilitative diffusion (Sasaki et al., 2001 [PubMed 11741323]).[supplied by OMIM, Mar 2008].


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.


##Evidence-Data-START## Transcript exon combination :: CR456373.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END##

RefSeq NP_001020110.1
CDS 147..1646
Misc Feature(1)198..1559
Misc Feature(2)198..1559
Misc Feature(3)429..>785
Misc Feature(4)<984..1526
Exon (1)1..176
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Exon (2)177..275
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Exon (3)276..436
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Exon (4)437..561
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Exon (5)562..691
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Exon (6)692..840
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Exon (7)841..1028
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Exon (8)1029..1139
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Exon (9)1140..1241
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Exon (10)1242..1317
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Exon (11)1318..1445
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Exon (12)1446..2348
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Translation MLHALLRSRMIQGRILLLTICAAGIGGTFQFGYNLSIINAPTLHIQEFTNETWQARTGEP LPDHLVLLMWSLIVSLYPLGGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRK AGSFEMIMLGRLLVGVNAGVSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVG LRELLGGPQAWPLLLASCLVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSG DLAGELEELEEERAACQGCRARRPWELFQHRALRRQVTSLVVLGSAMELCGNDSVYAYAS SVFRKAGVPEAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTCWGSIFTV ALCLQSSFPWTLYLAMACIFAFILSFGIGPAGVTGILATELFDQMARPAACMVCGALMWI MLILVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPETKGKTFQEISKELHRLNFP RRAQGPTWRSLEVIQSTEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
37+dbSNP:
37+a, gdbSNP:150968779
56+c, tdbSNP:17004019
71+a, tdbSNP:17550723
91+a, tdbSNP:199858184
114+a, gdbSNP:28538596
124+c, gdbSNP:201539753
196+dbSNP:
196+a, tdbSNP:201395239
209+c, tdbSNP:144569568
214+c, tdbSNP:138480653
235+a, tdbSNP:202104377
268+c, tdbSNP:180771325
269+a, gdbSNP:185337121
279+dbSNP:
279+a, gdbSNP:182920717
302+a, gdbSNP:2298376
310+a, cdbSNP:143033712
311+a, gdbSNP:146128345
332+c, tdbSNP:139920182
333+a, gdbSNP:7292659
344+c, tdbSNP:201945538
351+a, gdbSNP:144757871
353+a, gdbSNP:148531852
365+c, tdbSNP:201151293
424+c, tdbSNP:148218407
427+c, tdbSNP:147655616
430+g, tdbSNP:140623928
501+dbSNP:
501+c, tdbSNP:138317708
546+a, gdbSNP:112753934
560+a, cdbSNP:144550544
566+dbSNP:
566+a, gdbSNP:147844312
603+a, gdbSNP:140347594
625+c, gdbSNP:201126520
650+c, tdbSNP:200093458
660+a, gdbSNP:150346808
665+c, tdbSNP:201694819
675+c, tdbSNP:201471392
750+dbSNP:
750+a, gdbSNP:144951215
754+c, tdbSNP:149046335
764+c, tdbSNP:144615396
794+a, gdbSNP:138511811
795+c, tdbSNP:141517261
824+c, tdbSNP:145179201
828+a, gdbSNP:148376745
834+c, tdbSNP:199897068
837+c, gdbSNP:34605560
850+dbSNP:
850+a, gdbSNP:9608213
854+a, cdbSNP:9612499
904+a, gdbSNP:200373859
931+a, gdbSNP:192473607
933+c, tdbSNP:150867325
958+a, c, gdbSNP:139308916
1028+a, gdbSNP:199527068
1034+dbSNP:
1034+c, tdbSNP:201752284
1036+c, gdbSNP:143899804
1056+c, tdbSNP:200581467
1057+a, gdbSNP:36015336
1072+c, tdbSNP:140740332
1078+c, tdbSNP:200314415
1093+c, tdbSNP:144615650
1094+a, gdbSNP:185026065
1115+c, tdbSNP:147441026
1121+c, gdbSNP:148470395
1127..1128+, ggggdbSNP:140547058
1138+a, gdbSNP:199745405
1151+dbSNP:
1151+c, tdbSNP:142617508
1152+a, gdbSNP:79905160
1169+c, tdbSNP:140785969
1181+c, tdbSNP:143307696
1207+a, gdbSNP:146689657
1236+c, gdbSNP:140261431
1319+dbSNP:
1319+c, tdbSNP:113963201
1331+a, gdbSNP:145231987
1334+c, gdbSNP:138949711
1349+c, gdbSNP:36026871
1384+c, tdbSNP:189579613
1388+c, tdbSNP:143776564
1402+a, gdbSNP:142206009
1413+a, tdbSNP:34096096
1433+a, tdbSNP:143968836
1444+c, tdbSNP:200410084
1500+dbSNP:
1500+a, gdbSNP:60699980
1560+a, gdbSNP:60882514
1591+a, gdbSNP:143009100
1613+a, gdbSNP:150812024
1663+a, gdbSNP:60113317
1664+g, tdbSNP:56772479
1681+c, tdbSNP:72660220
1682+a, gdbSNP:200099627
1759+c, tdbSNP:41277537
1787+g, tdbSNP:142859161
1821+a, gdbSNP:76480802
1856+a, cdbSNP:6003939
1887+g, tdbSNP:186436250
2011+c, gdbSNP:190884614
2085+a, gdbSNP:182594944
2104+a, gdbSNP:188159063
2215+c, tdbSNP:192739185
2331+a, cdbSNP:5996625
2332..2334+, ccadbSNP:75950180
2333..2334+, adbSNP:35420058
2334..2337+, aaaadbSNP:56934395
2334..2335+, adbSNP:72175333
2334+, aaaadbSNP:72268895
2337+a, cdbSNP:78229548
Gene SymbolSLC2A11
Gene SynonymGLUT10; GLUT11; SLC2A11-a; SLC2A11-c
Chromosome22
Locus Map22q11.23
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001024938 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 3, mRNA. Full Length $664.68
ORF Sequence $432.39
NM_001024939 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA. Full Length $680.92
ORF Sequence $435.00
NM_030807 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 1, mRNA. Full Length $696.87
ORF Sequence $438.48
Title Multiple myeloma exhibits novel dependence on GLUT4, GLUT8, and GLUT11: implications for glucose transporter-directed therapy .
Author McBrayer,S.K., Cheng,J.C., Singhal,S., Krett,N.L., Rosen,S.T. and Shanmugam,M.
Journal Blood 119 (20), 4686-4697 (2012)
Title Polymorphisms in innate immunity genes and risk of childhood leukemia .
Author Han,S., Lan,Q., Park,A.K., Lee,K.M., Park,S.K., Ahn,H.S., Shin,H.Y., Kang,H.J., Koo,H.H., Seo,J.J., Choi,J.E., Ahn,Y.O., Chanock,S.J., Kim,H., Rothman,N. and Kang,D.
Journal Hum. Immunol. 71 (7), 727-730 (2010)
Title Risk of meningioma and common variation in genes related to innate immunity .
Author Rajaraman,P., Brenner,A.V., Neta,G., Pfeiffer,R., Wang,S.S., Yeager,M., Thomas,G., Fine,H.A., Linet,M.S., Rothman,N., Chanock,S.J. and Inskip,P.D.
Journal Cancer Epidemiol. Biomarkers Prev. 19 (5), 1356-1361 (2010)
Title Common variation in genes related to innate immunity and risk of adult glioma .
Author Rajaraman,P., Brenner,A.V., Butler,M.A., Wang,S.S., Pfeiffer,R.M., Ruder,A.M., Linet,M.S., Yeager,M., Wang,Z., Orr,N., Fine,H.A., Kwon,D., Thomas,G., Rothman,N., Inskip,P.D. and Chanock,S.J.
Journal Cancer Epidemiol. Biomarkers Prev. 18 (5), 1651-1658 (2009)
Title A highly conserved hydrophobic motif in the exofacial vestibule of fructose transporting SLC2A proteins acts as a critical determinant of their substrate selectivity .
Author Manolescu,A.R., Augustin,R., Moley,K. and Cheeseman,C.
Journal Mol. Membr. Biol. 24 (5-6), 455-463 (2007)
Title Characterization of the human SLC2A11 (GLUT11) gene: alternative promoter usage, function, expression, and subcellular distribution of three isoforms, and lack of mouse orthologue .
Author Scheepers,A., Schmidt,S., Manolescu,A., Cheeseman,C.I., Bell,A., Zahn,C., Joost,H.G. and Schurmann,A.
Journal Mol. Membr. Biol. 22 (4), 339-351 (2005)
Title A genome annotation-driven approach to cloning the human ORFeome .
Author Collins,J.E., Wright,C.L., Edwards,C.A., Davis,M.P., Grinham,J.A., Cole,C.G., Goward,M.E., Aguado,B., Mallya,M., Mokrab,Y., Huckle,E.J., Beare,D.M. and Dunham,I.
Journal Genome Biol. 5 (10), R84 (2004)
Title Cloning and characterization of glucose transporter 11, a novel sugar transporter that is alternatively spliced in various tissues .
Author Wu,X., Li,W., Sharma,V., Godzik,A. and Freeze,H.H.
Journal Mol. Genet. Metab. 76 (1), 37-45 (2002)
Title Molecular cloning of a member of the facilitative glucose transporter gene family GLUT11 (SLC2A11) and identification of transcription variants .
Author Sasaki,T., Minoshima,S., Shiohama,A., Shintani,A., Shimizu,A., Asakawa,S., Kawasaki,K. and Shimizu,N.
Journal Biochem. Biophys. Res. Commun. 289 (5), 1218-1224 (2001)
Title Characterization of human glucose transporter (GLUT) 11 (encoded by SLC2A11), a novel sugar-transport facilitator specifically expressed in heart and skeletal muscle .
Author Doege,H., Bocianski,A., Scheepers,A., Axer,H., Eckel,J., Joost,H.G. and Schurmann,A.
Journal Biochem. J. 359 (PT 2), 443-449 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878