Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA.
| RefSeq Version | NM_001024939.2, 190684652 |
| Length | 2348 bp |
| Structure | linear |
| Update Date | 09-FEB-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA. |
| Product | solute carrier family 2, facilitated glucose transporter member 11 isoform b |
| Comment | Summary: SLC2A11 belongs to a family of plasma membrane proteins that mediate transport of sugars across the membrane by facilitative diffusion (Sasaki et al., 2001 [PubMed 11741323]).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. |
| RefSeq | NP_001020110.1 |
| CDS | 147..1646 | Exon (1) | 1..176 | Exon (2) | 1..176 | Exon (3) | 177..275 | Exon (4) | 276..436 | Exon (5) | 437..561 | Exon (6) | 562..691 | Exon (7) | 692..840 | Exon (8) | 841..1028 | Exon (9) | 1029..1139 | Exon (10) | 1140..1241 | Exon (11) | 1242..1317 | Exon (12) | 1318..1445 | Exon (13) | 1446..2348 |
| Translation | MLHALLRSRMIQGRILLLTICAAGIGGTFQFGYNLSIINAPTLHIQEFTNETWQARTGEP
LPDHLVLLMWSLIVSLYPLGGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRK
AGSFEMIMLGRLLVGVNAGVSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVG
LRELLGGPQAWPLLLASCLVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSG
DLAGELEELEEERAACQGCRARRPWELFQHRALRRQVTSLVVLGSAMELCGNDSVYAYAS
SVFRKAGVPEAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTCWGSIFTV
ALCLQSSFPWTLYLAMACIFAFILSFGIGPAGVTGILATELFDQMARPAACMVCGALMWI
MLILVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPETKGKTFQEISKELHRLNFP
RRAQGPTWRSLEVIQSTEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 56 | + | c, t | dbSNP:17004019 |
| 71 | + | a, t | dbSNP:17550723 |
| 114 | + | a, g | dbSNP:28538596 |
| 302 | + | a, g | dbSNP:2298376 |
| 333 | + | a, g | dbSNP:7292659 |
| 546 | + | a, g | dbSNP:112753934 |
| 692 | + | , largedeletion | dbSNP:71797375 |
| 837 | + | c, g | dbSNP:34605560 |
| 850 | + | a, g | dbSNP:9608213 |
| 854 | + | a, c | dbSNP:9612499 |
| 1057 | + | a, g | dbSNP:36015336 |
| 1133 | + | g, t | dbSNP:80242040 |
| 1152 | + | a, g | dbSNP:79905160 |
| 1319 | + | c, t | dbSNP:113963201 |
| 1349 | + | c, g | dbSNP:36026871 |
| 1413 | + | a, t | dbSNP:34096096 |
| 1500 | + | a, g | dbSNP:60699980 |
| 1560 | + | a, g | dbSNP:60882514 |
| 1663 | + | a, g | dbSNP:60113317 |
| 1664 | + | g, t | dbSNP:56772479 |
| 1681 | + | c, t | dbSNP:72660220 |
| 1759 | + | c, t | dbSNP:41277537 |
| 1821 | + | a, g | dbSNP:76480802 |
| 1856 | + | a, c | dbSNP:6003939 |
| 2331 | + | a, c | dbSNP:5996625 |
| 2332..2334 | + | , cca | dbSNP:75950180 |
| 2333..2334 | + | , a | dbSNP:35420058 |
| 2334..2335 | + | , a | dbSNP:72175333 |
| 2337 | + | a, c | dbSNP:78229548 |
| 2341 | + | , aaaa | dbSNP:72268895 |
| Gene Symbol | SLC2A11 |
| Gene Synonym | GLUT10; GLUT11; MGC118830; MGC118833; SLC2A11-a; SLC2A11-c |
| Chromosome | 22 |
| Locus Map | 22q11.2 |
| All Transcripts | NM_001024939 , NM_001024938 , NM_030807 |
| Title | Polymorphisms in innate immunity genes and risk of childhood leukemia . |
| Author | Han,S., Lan,Q., Park,A.K., Lee,K.M., Park,S.K., Ahn,H.S., Shin,H.Y., Kang,H.J., Koo,H.H., Seo,J.J., Choi,J.E., Ahn,Y.O., Chanock,S.J., Kim,H., Rothman,N. and Kang,D. |
| Journal | Hum. Immunol. 71 (7), 727-730 (2010) |
| Title | Risk of meningioma and common variation in genes related to innate immunity . |
| Author | Rajaraman,P., Brenner,A.V., Neta,G., Pfeiffer,R., Wang,S.S., Yeager,M., Thomas,G., Fine,H.A., Linet,M.S., Rothman,N., Chanock,S.J. and Inskip,P.D. |
| Journal | Cancer Epidemiol. Biomarkers Prev. 19 (5), 1356-1361 (2010) |
| Title | Common variation in genes related to innate immunity and risk of adult glioma . |
| Author | Rajaraman,P., Brenner,A.V., Butler,M.A., Wang,S.S., Pfeiffer,R.M., Ruder,A.M., Linet,M.S., Yeager,M., Wang,Z., Orr,N., Fine,H.A., Kwon,D., Thomas,G., Rothman,N., Inskip,P.D. and Chanock,S.J. |
| Journal | Cancer Epidemiol. Biomarkers Prev. 18 (5), 1651-1658 (2009) |
| Title | A highly conserved hydrophobic motif in the exofacial vestibule of fructose transporting SLC2A proteins acts as a critical determinant of their substrate selectivity . |
| Author | Manolescu,A.R., Augustin,R., Moley,K. and Cheeseman,C. |
| Journal | Mol. Membr. Biol. 24 (5-6), 455-463 (2007) |
| Title | Characterization of the human SLC2A11 (GLUT11) gene: alternative promoter usage, function, expression, and subcellular distribution of three isoforms, and lack of mouse orthologue . |
| Author | Scheepers,A., Schmidt,S., Manolescu,A., Cheeseman,C.I., Bell,A., Zahn,C., Joost,H.G. and Schurmann,A. |
| Journal | Mol. Membr. Biol. 22 (4), 339-351 (2005) |
| Title | A genome annotation-driven approach to cloning the human ORFeome . |
| Author | Collins,J.E., Wright,C.L., Edwards,C.A., Davis,M.P., Grinham,J.A., Cole,C.G., Goward,M.E., Aguado,B., Mallya,M., Mokrab,Y., Huckle,E.J., Beare,D.M. and Dunham,I. |
| Journal | Genome Biol. 5 (10), R84 (2004) |
| Title | Cloning and characterization of glucose transporter 11, a novel sugar transporter that is alternatively spliced in various tissues . |
| Author | Wu,X., Li,W., Sharma,V., Godzik,A. and Freeze,H.H. |
| Journal | Mol. Genet. Metab. 76 (1), 37-45 (2002) |
| Title | Molecular cloning of a member of the facilitative glucose transporter gene family GLUT11 (SLC2A11) and identification of transcription variants . |
| Author | Sasaki,T., Minoshima,S., Shiohama,A., Shintani,A., Shimizu,A., Asakawa,S., Kawasaki,K. and Shimizu,N. |
| Journal | Biochem. Biophys. Res. Commun. 289 (5), 1218-1224 (2001) |
| Title | Characterization of human glucose transporter (GLUT) 11 (encoded by SLC2A11), a novel sugar-transport facilitator specifically expressed in heart and skeletal muscle . |
| Author | Doege,H., Bocianski,A., Scheepers,A., Axer,H., Eckel,J., Joost,H.G. and Schurmann,A. |
| Journal | Biochem. J. 359 (PT 2), 443-449 (2001) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |