• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu00721 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu00721C Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001024939.3, 544583532
Length 1500 bp
Structure linear
Update Date 18-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA.
Product solute carrier family 2, facilitated glucose transporter member 11 isoform b
Comment

Summary: This gene belongs to a family of proteins that mediate the transport of sugars across the cell membrane. The encoded protein transports glucose and fructose. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013].


Transcript Variant: This variant (2, also known as SLC2A11-c) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at an alternate start codon, compared to variant 1. The encoded isoform (b) is shorter and has a distinct N-terminus, compared to isoform a.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


##Evidence-Data-START## Transcript exon combination :: CR456373.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025088, ERS025090 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_001020110.1
CDS 148..1647
Misc Feature(1)202..1560
Misc Feature(2)202..1560
Misc Feature(3)337..1527
Misc Feature(4)order(367..369,376..381,388..390,400..405,409..414,
Exon (1)1..177
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Exon (2)178..276
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Exon (3)277..437
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Exon (4)438..562
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Exon (5)563..692
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Exon (6)693..841
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Exon (7)842..1029
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Exon (8)1030..1140
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Exon (9)1141..1242
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Exon (10)1243..1318
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Exon (11)1319..1446
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Exon (12)1447..2910
Gene:SLC2A11
Gene Synonym:GLUT10; GLUT11
Translation MLHALLRSRMIQGRILLLTICAAGIGGTFQFGYNLSIINAPTLHIQEFTNETWQARTGEP LPDHLVLLMWSLIVSLYPLGGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRK AGSFEMIMLGRLLVGVNAGVSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVG LRELLGGPQAWPLLLASCLVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSG DLAGELEELEEERAACQGCRARRPWELFQHRALRRQVTSLVVLGSAMELCGNDSVYAYAS SVFRKAGVPEAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTCWGSIFTV ALCLQSSFPWTLYLAMACIFAFILSFGIGPAGVTGILATELFDQMARPAACMVCGALMWI MLILVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPETKGKTFQEISKELHRLNFP RRAQGPTWRSLEVIQSTEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
38+dbSNP:
38+a, gdbSNP:150968779
57+c, tdbSNP:17004019
72+a, tdbSNP:17550723
92+a, tdbSNP:199858184
115+a, gdbSNP:28538596
125+c, gdbSNP:201539753
139+c, gdbSNP:377726165
163+c, tdbSNP:374068687
192+dbSNP:
192+c, gdbSNP:372619565
197+a, tdbSNP:201395239
210+c, tdbSNP:144569568
215+c, tdbSNP:138480653
236+a, tdbSNP:202104377
269+c, tdbSNP:180771325
270+a, gdbSNP:185337121
280+dbSNP:
280+a, gdbSNP:182920717
303+a, gdbSNP:2298376
312+a, gdbSNP:146128345
333+c, tdbSNP:139920182
334+a, gdbSNP:7292659
345+c, tdbSNP:201945538
352+a, gdbSNP:144757871
354+a, gdbSNP:148531852
366+c, tdbSNP:201151293
382+c, tdbSNP:375064380
425+c, tdbSNP:148218407
428+c, tdbSNP:147655616
431+g, tdbSNP:140623928
502+dbSNP:
502+c, tdbSNP:138317708
515+c, tdbSNP:368747902
537+a, gdbSNP:371425900
547+a, gdbSNP:112753934
561+a, cdbSNP:144550544
567+dbSNP:
567+a, gdbSNP:147844312
604+a, gdbSNP:140347594
626+c, gdbSNP:201126520
651+c, tdbSNP:200093458
653+c, tdbSNP:376689898
660+a, gdbSNP:369793820
661+a, gdbSNP:150346808
666+c, tdbSNP:201694819
667+a, gdbSNP:373984794
676+c, tdbSNP:201471392
747+dbSNP:
747+a, gdbSNP:369010639
750+c, tdbSNP:372713508
751+a, gdbSNP:144951215
755+c, tdbSNP:149046335
765+c, tdbSNP:144615396
766+a, gdbSNP:370970280
795+a, gdbSNP:138511811
796+c, tdbSNP:141517261
808+a, tdbSNP:370548146
825+c, tdbSNP:145179201
829+a, gdbSNP:148376745
835+c, tdbSNP:199897068
838+c, gdbSNP:34605560
846+dbSNP:
846+a, gdbSNP:375304001
851+a, gdbSNP:9608213
855+a, cdbSNP:9612499
864+c, tdbSNP:368660150
894+a, gdbSNP:370396623
904+c, tdbSNP:373807580
905+a, gdbSNP:200373859
932+a, gdbSNP:192473607
934+c, tdbSNP:150867325
938+c, tdbSNP:376897328
959+a, c, gdbSNP:139308916
1029+a, gdbSNP:199527068
1032+dbSNP:
1032+a, gdbSNP:367680987
1035+c, tdbSNP:201752284
1037+c, gdbSNP:143899804
1050+c, tdbSNP:371467287
1057+c, tdbSNP:200581467
1058+a, gdbSNP:36015336
1073+c, tdbSNP:140740332
1079+c, tdbSNP:200314415
1094+c, tdbSNP:144615650
1095+a, gdbSNP:185026065
1099+a, tdbSNP:372158845
1116+c, tdbSNP:147441026
1122+c, gdbSNP:148470395
1130..1131+, ggggdbSNP:140547058
1139+a, gdbSNP:199745405
1152+dbSNP:
1152+c, tdbSNP:142617508
1153+a, gdbSNP:79905160
1153+a, gdbSNP:386426422
1166+a, gdbSNP:369448246
1169+a, gdbSNP:372590867
1170+c, tdbSNP:140785969
1171+a, gdbSNP:377301649
1182+c, tdbSNP:143307696
1208+a, gdbSNP:146689657
1237+c, gdbSNP:140261431
1320+dbSNP:
1320+c, tdbSNP:113963201
1332+a, gdbSNP:145231987
1335+c, gdbSNP:138949711
1350+c, gdbSNP:36026871
1385+c, tdbSNP:189579613
1389+c, tdbSNP:143776564
1403+a, gdbSNP:142206009
1414+a, tdbSNP:34096096
1445+c, tdbSNP:200410084
1486+dbSNP:
1486+a, gdbSNP:372850687
1501+a, gdbSNP:60699980
1561+a, gdbSNP:60882514
1592+a, gdbSNP:143009100
1614+a, gdbSNP:150812024
1627+a, gdbSNP:376296700
1644+c, gdbSNP:374864398
1664..1665+ag, gtdbSNP:386820153
1664+a, gdbSNP:60113317
1665+g, tdbSNP:56772479
1682+c, tdbSNP:72660220
1683+a, gdbSNP:200099627
1760+c, tdbSNP:41277537
1788+g, tdbSNP:142859161
1810+c, gdbSNP:368340967
1822+a, gdbSNP:76480802
1857+a, cdbSNP:6003939
1888+g, tdbSNP:186436250
2012+c, gdbSNP:190884614
2086+a, gdbSNP:182594944
2105+a, gdbSNP:188159063
2197..2199+, aaadbSNP:377596707
2216+c, tdbSNP:192739185
2332+a, cdbSNP:5996625
2333..2335+, ccadbSNP:75950180
2334..2335+, adbSNP:35420058
2335..2336+, adbSNP:72175333
2338+a, cdbSNP:78229548
2351..2354+, aaaadbSNP:56934395
2354+a, tdbSNP:79366494
2356+a, tdbSNP:74816359
2504+a, cdbSNP:79276034
2539+a, tdbSNP:5996626
2541+a, gdbSNP:370031267
2557+g, tdbSNP:10427712
2563+a, gdbSNP:143975934
2667..2673+, tatatatdbSNP:147968130
2679+a, gdbSNP:182802150
2707+c, tdbSNP:58463409
2736+a, gdbSNP:386504535
2736+c, tdbSNP:1129067
2824+c, tdbSNP:10427750
complement(2862)-t, adbSNP:12966
2886+c, tdbSNP:142148508
2887+a, gdbSNP:146350859
Gene SymbolSLC2A11
Gene SynonymGLUT10; GLUT11
Chromosome22
Locus Map22q11.23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001024939 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_001024939 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_001024939 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_001024939 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 11 (SLC2A11), transcript variant 2, mRNA. On-demand $219.00 7-9
Title Multiple myeloma exhibits novel dependence on GLUT4, GLUT8, and GLUT11: implications for glucose transporter-directed therapy .
Author McBrayer SK, Cheng JC, Singhal S, Krett NL, Rosen ST and Shanmugam M.
Journal Blood 119 (20), 4686-4697 (2012)
Title A highly conserved hydrophobic motif in the exofacial vestibule of fructose transporting SLC2A proteins acts as a critical determinant of their substrate selectivity .
Author Manolescu AR, Augustin R, Moley K and Cheeseman C.
Journal Mol. Membr. Biol. 24 (5-6), 455-463 (2007)
Title Characterization of the human SLC2A11 (GLUT11) gene: alternative promoter usage, function, expression, and subcellular distribution of three isoforms, and lack of mouse orthologue .
Author Scheepers A, Schmidt S, Manolescu A, Cheeseman CI, Bell A, Zahn C, Joost HG and Schurmann A.
Journal Mol. Membr. Biol. 22 (4), 339-351 (2005)
Title GLUT11, but not GLUT8 or GLUT12, is expressed in human skeletal muscle in a fibre type-specific pattern .
Author Gaster M, Handberg A, Schurmann A, Joost HG, Beck-Nielsen H and Schroder HD.
Journal Pflugers Arch. 448 (1), 105-113 (2004)
Title Cloning and characterization of glucose transporter 11, a novel sugar transporter that is alternatively spliced in various tissues .
Author Wu X, Li W, Sharma V, Godzik A and Freeze HH.
Journal Mol. Genet. Metab. 76 (1), 37-45 (2002)
Title Molecular cloning of a member of the facilitative glucose transporter gene family GLUT11 (SLC2A11) and identification of transcription variants .
Author Sasaki T, Minoshima S, Shiohama A, Shintani A, Shimizu A, Asakawa S, Kawasaki K and Shimizu N.
Journal Biochem. Biophys. Res. Commun. 289 (5), 1218-1224 (2001)
Title Characterization of human glucose transporter (GLUT) 11 (encoded by SLC2A11), a novel sugar-transport facilitator specifically expressed in heart and skeletal muscle .
Author Doege H, Bocianski A, Scheepers A, Axer H, Eckel J, Joost HG and Schurmann A.
Journal Biochem. J. 359 (PT 2), 443-449 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.