|
You are here:
Biology CRO for Drug Discovery » Molecular Biology Services » Custom ORF Cloning Services » ORF Detail
 |
Mus musculus myelin basic protein (Mbp), transcript variant 8, mRNA.
| RefSeq Version | NM_001025245.1, 69885017 |
| Length | 4820 bp |
| Structure | linear |
| Update Date | 05-MAY-2011 |
| Organism | Mus musculus (house mouse) |
| Definition | Mus musculus myelin basic protein (Mbp), transcript variant 8, mRNA. |
| Product | Golli-Mbp isoform 2 |
| Comment | Summary: The protein encoded by the classic Mbp gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, Mbp-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long Mbp gene (otherwise called 'Golli-Mbp') that contains 3 additional exons located upstream of the classic Mbp exons. Alternative splicing from the Golli and the Mbp transcription start sites gives rise to 2 sets of Mbp-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-Mbp, spliced in-frame to 1 or more Mbp exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to Mbp aa sequence. The second family of transcripts contain only Mbp exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the Mbp transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes. Mutation of the Mbp gene is associated with the 'shiverer' and 'myelin deficient' phenotypes in mouse. [provided by RefSeq]. Transcript Variant: This variant (8) contains 3 exons unique to Golli-Mbp and exon 1 of the classic Mbp. It encodes the shorter of the Golli-Mbp isoforms (2). |
| RefSeq | NP_001020416.1 |
| CDS | 298..885 | Exon (1) | 1..272 | Exon (2) | 1..272 | Exon (3) | 273..348 | Exon (4) | 349..436 | Exon (5) | 437..4820 |
| Translation | MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAE
DTAVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTI
QEDPTAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGD
RGAPKRGSGKVSSEP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Gene Symbol | Mbp |
| Gene Synonym | C76307; golli-mbp; Hmbpr; mld; R75289; shi |
| Chromosome | 18 |
| Locus Map | 18 55.0 cM |
| All Transcripts | NM_010777 , NM_001025245 , NM_001025251 , NM_001025254 , NM_001025255 , NM_001025256 , NM_001025258 , NM_001025259 |
| Title | Myelin basic protein binds microtubules to a membrane surface and to actin filaments in vitro: effect of phosphorylation and deimination . |
| Author | Boggs,J.M., Rangaraj,G., Heng,Y.M., Liu,Y. and Harauz,G. |
| Journal | Biochim. Biophys. Acta 1808 (3), 761-773 (2011) |
| Title | TBR1 directly represses Fezf2 to control the laminar origin and development of the corticospinal tract . |
| Author | Han,W., Kwan,K.Y., Shim,S., Lam,M.M., Shin,Y., Xu,X., Zhu,Y., Li,M. and Sestan,N. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 108 (7), 3041-3046 (2011) |
| Title | Gdf11 facilitates temporal progression of neurogenesis in the developing spinal cord . |
| Author | Shi,Y. and Liu,J.P. |
| Journal | J. Neurosci. 31 (3), 883-893 (2011) |
| Title | Rheb1 is required for mTORC1 and myelination in postnatal brain development . |
| Author | Zou,J., Zhou,L., Du,X.X., Ji,Y., Xu,J., Tian,J., Jiang,W., Zou,Y., Yu,S., Gan,L., Luo,M., Yang,Q., Cui,Y., Yang,W., Xia,X., Chen,M., Zhao,X., Shen,Y., Chen,P.Y., Worley,P.F. and Xiao,B. |
| Journal | Dev. Cell 20 (1), 97-108 (2011) |
| Title | A high-resolution anatomical atlas of the transcriptome in the mouse embryo . |
| Author | Diez-Roux,G., Banfi,S., Sultan,M., Geffers,L., Anand,S., Rozado,D., Magen,A., Canidio,E., Pagani,M., Peluso,I., Lin-Marq,N., Koch,M., Bilio,M., Cantiello,I., Verde,R., De Masi,C., Bianchi,S.A., Cicchini,J., Perroud,E., Mehmeti,S., Dagand,E., Schrinner,S., Nurnberger,A., Schmidt,K., Metz,K., Zwingmann,C., Brieske,N., Springer,C., Hernandez,A.M., Herzog,S., Grabbe,F., Sieverding,C., Fischer,B., Schrader,K., Brockmeyer,M., Dettmer,S., Helbig,C., Alunni,V., Battaini,M.A., Mura,C., Henrichsen,C.N., Garcia-Lopez,R., Echevarria,D., Puelles,E., Garcia-Calero,E., Kruse,S., Uhr,M., Kauck,C., Feng,G., Milyaev,N., Ong,C.K., Kumar,L., Lam,M., Semple,C.A., Gyenesei,A., Mundlos,S., Radelof,U., Lehrach,H., Sarmientos,P., Reymond,A., Davidson,D.R., Dolle,P., Antonarakis,S.E., Yaspo,M.L., Martinez,S., Baldock,R.A., Eichele,G. and Ballabio,A. |
| Journal | PLoS Biol. 9 (1), E1000582 (2011) |
| Title | A novel transcript overlapping the myelin basic protein gene . |
| Author | Grima,B., Zelenika,D. and Pessac,B. |
| Journal | J. Neurochem. 59 (6), 2318-2323 (1992) |
| Title | Absence of the major dense line in myelin of the mutant mouse 'shiverer' . |
| Author | Privat,A., Jacque,C., Bourre,J.M., Dupouey,P. and Baumann,N. |
| Journal | Neurosci. Lett. 12 (1), 107-112 (1979) |
| Title | Immunochemical studies of myelin basic protein in shiverer mouse devoid of major dense line of myelin . |
| Author | Dupouey,P., Jacque,C., Bourre,J.M., Cesselin,F., Privat,A. and Baumann,N. |
| Journal | Neurosci. Lett. 12 (1), 113-118 (1979) |
| Title | Brain lipid composition of the shiverer mouse: (genetic defect in myelin development) . |
| Author | Bird,T.D., Farrell,D.F. and Sumi,S.M. |
| Journal | J. Neurochem. 31 (1), 387-391 (1978) |
| Title | Myelin deficient, a new neurological mutant in the mouse . |
| Author | Doolittle,D.P. and Schweikart,K.M. |
| Journal | J. Hered. 68 (5), 331-332 (1977) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |