• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ryanodine receptor 2 (cardiac) (RYR2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001035 Homo sapiens ryanodine receptor 2 (cardiac) (RYR2), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_001035.2, 112799846
Length 16365 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ryanodine receptor 2 (cardiac) (RYR2), mRNA.
Product ryanodine receptor 2
Comment

Summary: This gene encodes a ryanodine receptor found in cardiac muscle sarcoplasmic reticulum. The encoded protein is one of the components of a calcium channel, composed of a tetramer of the ryanodine receptor proteins and a tetramer of FK506 binding protein 1B proteins, that supplies calcium to cardiac muscle. Mutations in this gene are associated with stress-induced polymorphic ventricular tachycardia and arrhythmogenic right ventricular dysplasia. [provided by RefSeq, Jul 2008].


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001026.2
CDS 121..15024
Misc Feature(1)145..777
Misc Feature(2)145..777
Misc Feature(3)448..615
Misc Feature(4)796..1317
Misc Feature(5)976..>1092
Misc Feature(6)1471..2085
Misc Feature(7)2134..2544
Misc Feature(8)2677..8895
Misc Feature(9)2701..2985
Misc Feature(10)3043..3327
Misc Feature(11)3415..3780
Misc Feature(12)4387..4803
Misc Feature(13)6487..7116
Misc Feature(14)8218..8502
Misc Feature(15)8542..8544
Misc Feature(16)8542..8544
Misc Feature(17)8560..8562
Misc Feature(18)8578..8844
Misc Feature(19)10861..10950
Misc Feature(20)11596..11964
Misc Feature(21)11983..12132
Misc Feature(22)12208..12375
Misc Feature(23)12217..12381
Misc Feature(24)order(12226..12228,12232..12234,12238..12240,12259..12261,
Misc Feature(25)12964..13026
Misc Feature(26)13117..>13359
Misc Feature(27)<13579..13917
Misc Feature(28)13630..13692
Misc Feature(29)13858..13920
Misc Feature(30)14308..14370
Misc Feature(31)14425..14487
Misc Feature(32)14668..14730
Exon (1)1..168
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (2)169..288
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (3)289..393
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (4)394..414
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (5)415..429
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (6)430..504
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (7)505..583
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (8)584..696
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (9)697..796
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (10)797..893
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (11)894..968
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (12)969..1125
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (13)1126..1290
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (14)1291..1412
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (15)1413..1596
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (16)1597..1732
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (17)1733..1828
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (18)1829..1947
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (19)1948..2081
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (20)2082..2323
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (21)2324..2516
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (22)2517..2733
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (23)2734..2838
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (24)2839..2942
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (25)2943..3026
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (26)3027..3186
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (27)3187..3334
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (28)3335..3543
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (29)3544..3718
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (30)3719..3927
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (31)3928..4280
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (32)4281..4395
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (33)4396..4556
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (34)4557..4716
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (35)4717..4803
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (36)4804..5030
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (37)5031..5835
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (38)5836..6036
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (39)6037..6142
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (40)6143..6286
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (41)6287..6560
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (42)6561..6675
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (43)6676..6808
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (44)6809..6912
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (45)6913..7048
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (46)7049..7235
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (47)7236..7341
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (48)7342..7462
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (49)7463..7632
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (50)7633..7853
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (51)7854..7944
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (52)7945..8085
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (53)8086..8249
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (54)8250..8328
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (55)8329..8418
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (56)8419..8556
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (57)8557..8634
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (58)8635..8710
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (59)8711..8834
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (60)8835..8950
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (61)8951..9015
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (62)9016..9137
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (63)9138..9187
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (64)9188..9248
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (65)9249..9487
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (66)9488..9569
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (67)9570..9700
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (68)9701..10021
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (69)10022..10262
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (70)10263..10350
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (71)10351..10443
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (72)10444..10614
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (73)10615..10674
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (74)10675..10809
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (75)10810..10845
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (76)10846..10958
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (77)10959..11055
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (78)11056..11159
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (79)11160..11211
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (80)11212..11265
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (81)11266..11365
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (82)11366..11445
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (83)11446..11522
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (84)11523..11596
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (85)11597..11677
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (86)11678..11766
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (87)11767..11895
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (88)11896..12000
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (89)12001..12082
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (90)12083..13380
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (91)13381..13448
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (92)13449..13596
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (93)13597..13683
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (94)13684..13902
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (95)13903..14033
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (96)14034..14076
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (97)14077..14210
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (98)14211..14271
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (99)14272..14418
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (100)14419..14553
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (101)14554..14710
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (102)14711..14775
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (103)14776..14876
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (104)14877..14928
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Exon (105)14929..16365
Gene:RYR2
Gene Synonym:ARVC2; ARVD2; RyR; RYR-2; VTSIP
Translation MADGGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP DLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAIL LRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD LILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH MDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV TTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSV CYIQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIR STVFLFNRFIRGLDALSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR ALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAAL IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGD DLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREY KQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEDK VKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGI QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSG TGERFRIFRAEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGF KAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDG FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ VPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFSKTVAG GLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEK PSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPAN VWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGR NNNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRI KNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQ CLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHV DEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFP DENKKHGLPGIGLSTSLRPRMQFSSPSFVSISNECYQYSPEFPLDILKSKTIQMLTEAVK EGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAATPEEE SDTLEKELSVDDAKLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRH RIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFK DDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLK KKQAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVR ALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPN LMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSY LLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQML VSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGG NGLLAAMEEAIKIAEDPSRDGPSPNSGSSKTLDTEEEEDDTIHMGNAIMTFYSALIDLLG RCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGF CPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYL CTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQL RPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHL SRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGN FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPY KLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHG YSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAK EKAKDREKAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYI LEFDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKE KEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAF LDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGED LILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNI YSIYNTKSSRERAALSLPTNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILP MLCSYMSRWWEHGPENNPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLA VFSQPIINKVKPQLLKTHFLPLMEKLKKKAATVVSEEDHLKAEARGDMSEAELLILDEFT TLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFV VQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNI CAPGDQELIALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTDD TSDPEKTVERVLDIANVLFHLEQKSKRVGRRHYCLVEHPQRSKKAVWHKLLSKQRKRAVV ACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKR VDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEME KQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDY LKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLF RFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDE QGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQ DSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMF LKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDY EEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMG SAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEM QLAAQISESDLNERSANKEESEKERPEEQGPRMAFFSILTVRSALFALRYNILTLMRMLS LKSLKKQMKKVKKMTVKDMVTAFFSSYWSIFMTLLHFVASVFRGFFRIICSLLLGGSLVE GAKKIKVAELLANMPDPTQDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIF GLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPE KAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFY NMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSSSHRIIAVHYV LEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQ PSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFS DAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFA AHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGD TPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLA IIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLF FLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
256+dbSNP:
256+a, cdbSNP:200643211
384+a, gdbSNP:148850606
676+dbSNP:
676+a, gdbSNP:201211033
735+dbSNP:
735+c, tdbSNP:112680790
769+a, gdbSNP:200642525
804+dbSNP:
804+c, tdbSNP:72549417
825+a, gdbSNP:200318226
846+c, tdbSNP:76380341
915+dbSNP:
915+c, tdbSNP:189449390
948+a, gdbSNP:180711819
991+dbSNP:
991+g, tdbSNP:80303323
1012..1013+, cdbSNP:35041432
1102+a, gdbSNP:201669522
1173+dbSNP:
1173+a, gdbSNP:187565743
1230+a, gdbSNP:150705689
1239+c, tdbSNP:202231354
1254+c, tdbSNP:193922621
1255+a, gdbSNP:199693714
1286+a, gdbSNP:200685968
1299+dbSNP:
1299+g, tdbSNP:80313920
1327+a, gdbSNP:142797573
1338+a, gdbSNP:147389346
1378+c, tdbSNP:190140598
1416+dbSNP:
1416+a, cdbSNP:184176405
1418+c, tdbSNP:121918602
1479+c, tdbSNP:3765097
1515+c, gdbSNP:111990043
1564+c, tdbSNP:117903753
1631+dbSNP:
1631+a, gdbSNP:201600087
1639+a, gdbSNP:16835270
1668+c, tdbSNP:146129084
1731+a, gdbSNP:78281932
1896+dbSNP:
1896+a, tdbSNP:72549414
1983+dbSNP:
1983+c, tdbSNP:17686573
2059+c, tdbSNP:202040519
2093+dbSNP:
2093+a, gdbSNP:2009813
2166+a, gdbSNP:116098815
2201+a, gdbSNP:190787113
2343+dbSNP:
2343+a, gdbSNP:117242563
2387+a, gdbSNP:193922623
2421+g, tdbSNP:117588730
2477+a, gdbSNP:182778119
2509+a, gdbSNP:200121281
2513+c, tdbSNP:187464772
2514+a, gdbSNP:192876953
2627+dbSNP:
2627+a, cdbSNP:76474894
2779+dbSNP:
2779+a, gdbSNP:180862949
2831+a, gdbSNP:201131315
2875+dbSNP:
2875+a, gdbSNP:201079716
2880+a, gdbSNP:186181155
2883+c, tdbSNP:4336838
2958+dbSNP:
2958+a, gdbSNP:188487794
3055+dbSNP:
3055+g, tdbSNP:202015519
3084+c, tdbSNP:202085370
3093+c, tdbSNP:2253273
3150+c, tdbSNP:138064129
3158+a, gdbSNP:149514924
3174+c, tdbSNP:113422365
3260..3261+dbSNP:
3260..3261+, gdbSNP:34393867
3272+a, gdbSNP:79457258
3336+dbSNP:
3336+a, gdbSNP:200208935
3350+c, tdbSNP:202176504
3371+a, gdbSNP:193922624
3378+a, tdbSNP:201733110
3440+c, tdbSNP:200236750
3476+a, gdbSNP:201312753
3481+c, gdbSNP:199682282
3500+a, gdbSNP:200525962
3527+c, tdbSNP:72549415
3551+dbSNP:
3551+a, gdbSNP:193125030
3714+c, tdbSNP:185212949
3716+a, gdbSNP:149760466
3841+dbSNP:
3841+a, gdbSNP:185715460
3855+a, gdbSNP:190884873
3969+dbSNP:
3969+a, gdbSNP:143603583
4003+a, gdbSNP:200574919
4041+a, gdbSNP:201469656
4160+g, tdbSNP:193922625
4188+c, tdbSNP:199821105
4189+c, gdbSNP:193922626
4316+dbSNP:
4316+a, cdbSNP:75901196
4318+a, gdbSNP:56229512
4585+dbSNP:
4585+c, tdbSNP:200450676
4647+g, tdbSNP:138270661
4655+a, gdbSNP:79956707
4725+dbSNP:
4725+a, gdbSNP:201916326
4757..4758+, adbSNP:36013103
4772+a, gdbSNP:185237690
4812+dbSNP:
4812+a, gdbSNP:201675951
4854+c, tdbSNP:201880756
4860+a, gdbSNP:79811945
4867+c, tdbSNP:200070226
5109+dbSNP:
5109+c, tdbSNP:147060179
5166+a, cdbSNP:3766870
5268+a, tdbSNP:199988609
5274+a, gdbSNP:114534505
5520+a, gdbSNP:3820216
5574+c, tdbSNP:201218861
5673+a, tdbSNP:75230115
5706+c, tdbSNP:193922628
5733+c, tdbSNP:116774472
5772+g, tdbSNP:202117250
5773+g, tdbSNP:200197527
5774+a, gdbSNP:41315858
5776+a, gdbSNP:3766871
5803+a, cdbSNP:79660660
5876+dbSNP:
5876+a, gdbSNP:199893812
5955+c, tdbSNP:189299988
6043+dbSNP:
6043+a, gdbSNP:200318013
6404+dbSNP:
6404+c, tdbSNP:142498105
6457+a, gdbSNP:186906598
6857+dbSNP:
6857+c, tdbSNP:121918597
7026+dbSNP:
7026+a, gdbSNP:707189
7102+dbSNP:
7102+c, tdbSNP:121918603
7158+a, cdbSNP:116601686
7182+c, tdbSNP:182038403
7195+a, cdbSNP:200921429
7269+dbSNP:
7269+c, tdbSNP:183606632
7277+a, tdbSNP:121918601
7397+dbSNP:
7397+c, tdbSNP:28677142
7423+g, tdbSNP:188835713
7471+dbSNP:
7471+a, gdbSNP:140798752
7485+c, tdbSNP:72549416
7542+c, gdbSNP:121918598
7608+c, tdbSNP:143906555
7615+a, gdbSNP:191850147
7739+a, gdbSNP:200105499
7809+a, gdbSNP:201082550
7926+dbSNP:
7926+a, gdbSNP:684923
7927+a, gdbSNP:59331340
8158+dbSNP:
8158+g, tdbSNP:181732213
8180+a, gdbSNP:202020477
8265+dbSNP:
8265+g, tdbSNP:200420897
8282+c, tdbSNP:201500134
8393+dbSNP:
8393+a, gdbSNP:200053476
8568+dbSNP:
8568+c, tdbSNP:144876996
8993+dbSNP:
8993+a, gdbSNP:34967813
9214+dbSNP:
9214+g, tdbSNP:193007458
9438+dbSNP:
9438+g, tdbSNP:2797436
9574+dbSNP:
9574+c, tdbSNP:181105904
9680+a, gdbSNP:184218219
9786+dbSNP:
9786+c, tdbSNP:116442127
9987+a, gdbSNP:190537182
10043+dbSNP:
10043+a, gdbSNP:201081663
10047+a, gdbSNP:184937795
10083+a, gdbSNP:199730192
10142+a, gdbSNP:201827665
10167+a, gdbSNP:144428932
10374+dbSNP:
10374+c, tdbSNP:138073811
10501+dbSNP:
10501+a, gdbSNP:147512481
10572+g, tdbSNP:199498105
10623+dbSNP:
10623+c, tdbSNP:2797441
10643+c, tdbSNP:115622575
10648+a, c, tdbSNP:201749277
10731+dbSNP:
10731+a, gdbSNP:183911939
10761+a, gdbSNP:144256966
10896+dbSNP:
10896+c, tdbSNP:2685301
10931+g, tdbSNP:56228594
11095+dbSNP:
11095+a, cdbSNP:184527312
11246+dbSNP:
11246+a, tdbSNP:200013680
11677+dbSNP:
11677+a, gdbSNP:12742148
11955+dbSNP:
11955+c, tdbSNP:78939657
12108+dbSNP:
12108+c, tdbSNP:56226196
12279+a, gdbSNP:41267517
12432+c, gdbSNP:121918599
12435+c, tdbSNP:184625125
12444+c, tdbSNP:189205421
12451+a, cdbSNP:192890834
12722+a, gdbSNP:121918605
12747+a, gdbSNP:3753631
12789+a, gdbSNP:147887477
12962+c, tdbSNP:201829896
12978+c, tdbSNP:185482345
12979+c, tdbSNP:190009333
13008..13009+, tdbSNP:34238075
13039+c, tdbSNP:200092869
13449+dbSNP:
13449+g, tdbSNP:77959278
13530+c, tdbSNP:183933829
13609+dbSNP:
13609+c, tdbSNP:121918600
13686+dbSNP:
13686+c, tdbSNP:57360419
13720+c, tdbSNP:199624074
13786+a, gdbSNP:189345192
13832+c, tdbSNP:200803276
13860+a, gdbSNP:115854664
14077+dbSNP:
14077+g, tdbSNP:121918604
14097+a, gdbSNP:78369334
14103+c, tdbSNP:138498780
14149+c, tdbSNP:112864477
14314+dbSNP:
14314+a, cdbSNP:201119364
14434+dbSNP:
14434+a, gdbSNP:193922622
14541+c, tdbSNP:75206601
14601+dbSNP:
14601+a, c, tdbSNP:114303476
14699+c, gdbSNP:121918606
14823+dbSNP:
14823+c, gdbSNP:201371633
15079+c, tdbSNP:192720264
15080+a, cdbSNP:74703306
15153+c, gdbSNP:16835891
15154+a, gdbSNP:12725752
15209+c, gdbSNP:113799947
15244..15245+, gdbSNP:35922043
15254+a, gdbSNP:28497968
15278+c, tdbSNP:146899712
15352+c, tdbSNP:76286925
15423+a, gdbSNP:184537159
15590..15591+, tdbSNP:113047070
15671+c, tdbSNP:16835894
15729+, cdbSNP:35582606
15734..15741+, cccccccgdbSNP:202053866
15738+c, gdbSNP:12406863
15805+a, tdbSNP:139272315
15811+a, cdbSNP:143228973
15911..15912+, aaacdbSNP:10692285
15912..15913+, aaacdbSNP:71810573
15914..15915+, acaadbSNP:35932221
15917..15918+, acaadbSNP:10667874
16004+c, tdbSNP:147077947
16164+a, gdbSNP:12594
16170+a, gdbSNP:138220876
16184+a, gdbSNP:114925843
16239+c, tdbSNP:149588183
16331+c, tdbSNP:16835904
Gene SymbolRYR2
Gene SynonymARVC2; ARVD2; RyR; RYR-2; VTSIP
Chromosome1
Locus Map1q43
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001035 Homo sapiens ryanodine receptor 2 (cardiac) (RYR2), mRNA. On-demand TBD TBD
Title Ligand-dependent conformational changes in the clamp region of the cardiac ryanodine receptor .
Author Tian,X., Liu,Y., Liu,Y., Wang,R., Wagenknecht,T., Liu,Z. and Chen,S.R.
Journal J. Biol. Chem. 288 (6), 4066-4075 (2013)
Title Heterogeneity of ryanodine receptor dysfunction in a mouse model of catecholaminergic polymorphic ventricular tachycardia .
Author Loaiza,R., Benkusky,N.A., Powers,P.P., Hacker,T., Noujaim,S., Ackerman,M.J., Jalife,J. and Valdivia,H.H.
Journal Circ. Res. 112 (2), 298-308 (2013)
Title Bidirectional coupling between ryanodine receptors and Ca2+ release-activated Ca2+ (CRAC) channel machinery sustains store-operated Ca2+ entry in human T lymphocytes .
Author Thakur,P., Dadsetan,S. and Fomina,A.F.
Journal J. Biol. Chem. 287 (44), 37233-37244 (2012)
Title Familial evaluation in catecholaminergic polymorphic ventricular tachycardia: disease penetrance and expression in cardiac ryanodine receptor mutation-carrying relatives .
Author van der Werf,C., Nederend,I., Hofman,N., van Geloven,N., Ebink,C., Frohn-Mulder,I.M., Alings,A.M., Bosker,H.A., Bracke,F.A., van den Heuvel,F., Waalewijn,R.A., Bikker,H., van Tintelen,J.P., Bhuiyan,Z.A., van den Berg,M.P. and Wilde,A.A.
Journal Circ Arrhythm Electrophysiol 5 (4), 748-756 (2012)
Title A mechanistic description of gating of the human cardiac ryanodine receptor in a regulated minimal environment .
Author Mukherjee,S., Thomas,N.L. and Williams,A.J.
Journal J. Gen. Physiol. 140 (2), 139-158 (2012)
Title The human cardiac muscle ryanodine receptor-calcium release channel: identification, primary structure and topological analysis .
Author Tunwell,R.E., Wickenden,C., Bertrand,B.M., Shevchenko,V.I., Walsh,M.B., Allen,P.D. and Lai,F.A.
Journal Biochem. J. 318 (PT 2), 477-487 (1996)
Title Association of sorcin with the cardiac ryanodine receptor .
Author Meyers,M.B., Pickel,V.M., Sheu,S.S., Sharma,V.K., Scotto,K.W. and Fishman,G.I.
Journal J. Biol. Chem. 270 (44), 26411-26418 (1995)
Title A new locus for arrhythmogenic right ventricular cardiomyopathy (ARVD2) maps to chromosome 1q42-q43 .
Author Rampazzo,A., Nava,A., Erne,P., Eberhard,M., Vian,E., Slomp,P., Tiso,N., Thiene,G. and Danieli,G.A.
Journal Hum. Mol. Genet. 4 (11), 2151-2154 (1995)
Title Chromosome mapping of five human cardiac and skeletal muscle sarcoplasmic reticulum protein genes .
Author Otsu,K., Fujii,J., Periasamy,M., Difilippantonio,M., Uppender,M., Ward,D.C. and MacLennan,D.H.
Journal Genomics 17 (2), 507-509 (1993)
Title Molecular cloning of cDNA encoding the Ca2+ release channel (ryanodine receptor) of rabbit cardiac muscle sarcoplasmic reticulum .
Author Otsu,K., Willard,H.F., Khanna,V.K., Zorzato,F., Green,N.M. and MacLennan,D.H.
Journal J. Biol. Chem. 265 (23), 13472-13483 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.