• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu22367 Homo sapiens EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu22367C Homo sapiens EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001039348.2, 320118885
Length 1482 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, mRNA.
Product EGF-containing fibulin-like extracellular matrix protein 1 precursor
Comment

Summary: This gene encodes a member of the fibulin family of extracellular matrix glycoproteins. Like all members of this family, the encoded protein contains tandemly repeated epidermal growth factor-like repeats followed by a C-terminus fibulin-type domain. This gene is upregulated in malignant gliomas and may play a role in the aggressive nature of these tumors. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy. Alternatively spliced transcript variants that encode the same protein have been described.[provided by RefSeq, Nov 2009].


Transcript Variant: This variant (2) represents the longer transcript. Variants 2 and 3 encode the same protein.

RefSeq NP_001034437.1
CDS 502..1983
Misc Feature(1)19..21
Misc Feature(2)19..21
Misc Feature(3)1018..1140
Misc Feature(4)order(1018..1020,1027..1029,1075..1077)
Misc Feature(5)1141..1236
Misc Feature(6)order(1141..1143,1150..1152,1189..1191)
Misc Feature(7)<1255..1374
Misc Feature(8)1276..1980
Misc Feature(9)1321..1392
Misc Feature(10)<1375..1473
Misc Feature(11)1501..>1578
Exon (1)1..453
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Exon (2)454..494
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Exon (3)495..582
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Exon (4)583..631
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Exon (5)632..1018
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Exon (6)1019..1141
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Exon (7)1142..1261
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Exon (8)1262..1381
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Exon (9)1382..1501
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Exon (10)1502..1625
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Exon (11)1626..1821
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Exon (12)1822..3094
Gene:EFEMP1
Gene Synonym:DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Translation MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK CVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVA SAAAVAGPEMQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAG THNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCS PGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHGGFRCY PRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS VLRLTIIVGPFSF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(20)-t, cdbSNP:181925896
complement(38)-g, adbSNP:72811724
complement(42)-t, gdbSNP:79563212
complement(134)-g, cdbSNP:111619737
complement(218)-g, adbSNP:189647029
306+c, tdbSNP:3762514
complement(321)-g, adbSNP:28510596
complement(414)-g, adbSNP:143361440
complement(416)-g, adbSNP:139902612
complement(435)-g, adbSNP:3762515
438+c, tdbSNP:3762516
complement(442)-t, cdbSNP:192789765
complement(450)-t, cdbSNP:10167115
complement(456..457)-dbSNP:
complement(456..457)-, adbSNP:35004735
complement(463)-t, gdbSNP:144127545
complement(475..476)-, cdbSNP:35393035
complement(486)-t, adbSNP:187417918
complement(519)-g, adbSNP:182486751
complement(547)-t, gdbSNP:150463947
complement(594)-dbSNP:
complement(594)-g, adbSNP:141747986
complement(619)-t, gdbSNP:374767112
complement(620)-t, cdbSNP:372649180
complement(628)-t, gdbSNP:371658999
complement(639)-dbSNP:
complement(639)-g, adbSNP:138017183
complement(647)-t, gdbSNP:55849640
complement(660)-g, adbSNP:17047322
complement(696)-g, adbSNP:142572513
complement(708)-t, gdbSNP:386523624
complement(708)-c, adbSNP:12292
complement(717)-t, cdbSNP:376553875
complement(735)-g, adbSNP:202147132
complement(747)-g, adbSNP:35447389
complement(768)-t, cdbSNP:373374071
complement(798..799)-, cdbSNP:35441215
complement(798)-g, adbSNP:142637468
complement(799)-t, cdbSNP:150201810
complement(819)-g, cdbSNP:369150030
complement(826)-t, cdbSNP:143704611
complement(840)-c, adbSNP:200070678
complement(847)-t, cdbSNP:147918399
complement(877)-t, cdbSNP:373554215
complement(888)-g, adbSNP:14282
complement(930)-t, cdbSNP:368195380
complement(944)-t, cdbSNP:374747361
complement(968)-t, cdbSNP:370831953
complement(1008)-g, adbSNP:149890382
complement(1024)-dbSNP:
complement(1024)-t, cdbSNP:184503723
complement(1026)-g, adbSNP:151171192
complement(1040)-t, cdbSNP:199946928
1081+c, tdbSNP:398123542
complement(1128)-t, cdbSNP:373664722
complement(1138)-t, cdbSNP:369629631
complement(1176)-dbSNP:
complement(1176)-g, adbSNP:371553398
complement(1185)-g, adbSNP:139930646
complement(1233)-t, cdbSNP:199622147
complement(1258)-t, cdbSNP:142542256
complement(1286)-dbSNP:
complement(1286)-t, cdbSNP:148488868
complement(1308)-g, adbSNP:138120227
complement(1385)-dbSNP:
complement(1385)-g, adbSNP:373857382
complement(1395)-g, adbSNP:374256179
complement(1413)-t, cdbSNP:143083501
complement(1425)-t, cdbSNP:146846635
complement(1455)-g, adbSNP:148177279
complement(1490)-t, cdbSNP:150399072
1534+dbSNP:
1534+c, tdbSNP:121434491
complement(1574)-t, cdbSNP:372748426
complement(1586)-t, cdbSNP:369049569
complement(1620)-t, cdbSNP:148823921
complement(1651)-dbSNP:
complement(1651)-g, cdbSNP:367901228
complement(1661)-t, cdbSNP:146446706
complement(1712)-g, cdbSNP:139142559
complement(1753)-t, cdbSNP:142194873
complement(1820)-t, cdbSNP:373990093
complement(1849)-dbSNP:
complement(1849)-t, cdbSNP:374643957
complement(1851)-c, adbSNP:147448993
complement(1855)-t, cdbSNP:139171666
complement(1869)-t, cdbSNP:149616551
complement(1888)-t, cdbSNP:367718707
complement(1914)-g, adbSNP:374690853
complement(1921)-g, cdbSNP:200959130
complement(1931)-t, cdbSNP:201035117
complement(1933)-t, gdbSNP:150488038
complement(1979)-g, adbSNP:112871166
complement(1989)-, adbSNP:200536754
complement(1992)-t, cdbSNP:199663914
complement(2050)-t, adbSNP:150344322
complement(2083)-g, adbSNP:113974409
2151+a, gdbSNP:1802574
complement(2231)-t, gdbSNP:117386259
complement(2232)-g, adbSNP:373737354
complement(2240)-g, cdbSNP:181180919
complement(2372)-g, adbSNP:375379036
complement(2435..2436)-, adbSNP:35704713
2444+a, gdbSNP:1061326
complement(2490)-g, adbSNP:188698134
complement(2516)-g, adbSNP:56411268
2540+c, tdbSNP:1063452
complement(2565..2566)-, adbSNP:55878434
complement(2632)-g, adbSNP:186888998
complement(2670)-g, adbSNP:138843899
2678+c, tdbSNP:3791680
complement(2679)-g, cdbSNP:181823941
complement(2783)-g, adbSNP:146101049
complement(2786)-t, gdbSNP:112572819
complement(2945)-t, gdbSNP:77386452
complement(2946)-t, cdbSNP:190519603
complement(2976)-t, gdbSNP:185614902
2987+c, gdbSNP:1802575
complement(3045)-g, adbSNP:142276628
complement(3046)-t, cdbSNP:112334283
complement(3048)-t, cdbSNP:147551451
complement(3094)-t, cdbSNP:192552476
Gene SymbolEFEMP1
Gene SynonymDHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Chromosome2
Locus Map2p16
Title Fibulin-3, -4, and -5 are highly susceptible to proteolysis, interact with cells and heparin, and form multimers .
Author Djokic J, Fagotto-Kaufmann C, Bartels R, Nelea V and Reinhardt DP.
Journal J. Biol. Chem. 288 (31), 22821-22835 (2013)
Title Decrease of fibulin-3 in hepatocellular carcinoma indicates poor prognosis .
Author Luo R, Zhang M, Liu L, Lu S, Zhang CZ and Yun J.
Journal PLoS ONE 8 (8), E70511 (2013)
Title Epigenetic inactivation of EFEMP1 is associated with tumor suppressive function in endometrial carcinoma .
Author Yang T, Qiu H, Bao W, Li B, Lu C, Du G, Luo X, Wang L and Wan X.
Journal PLoS ONE 8 (6), E67458 (2013)
Title Transcriptional regulation and expression of the dominant drusen gene FBLN3 (EFEMP1) in mammalian retina .
Author Blackburn J, Tarttelin EE, Gregory-Evans CY, Moosajee M and Gregory-Evans K.
Journal Invest. Ophthalmol. Vis. Sci. 44 (11), 4613-4621 (2003)
Title Aberrant accumulation of EFEMP1 underlies drusen formation in Malattia Leventinese and age-related macular degeneration .
Author Marmorstein LY, Munier FL, Arsenijevic Y, Schorderet DF, McLaughlin PJ, Chung D, Traboulsi E and Marmorstein AD.
Journal Proc. Natl. Acad. Sci. U.S.A. 99 (20), 13067-13072 (2002)
Title Sequence, recombinant expression and tissue localization of two novel extracellular matrix proteins, fibulin-3 and fibulin-4 .
Author Giltay R, Timpl R and Kostka G.
Journal Matrix Biol. 18 (5), 469-480 (1999)
Title A single EFEMP1 mutation associated with both Malattia Leventinese and Doyne honeycomb retinal dystrophy .
Author Stone EM, Lotery AJ, Munier FL, Heon E, Piguet B, Guymer RH, Vandenburgh K, Cousin P, Nishimura D, Swiderski RE, Silvestri G, Mackey DA, Hageman GS, Bird AC, Sheffield VC and Schorderet DF.
Journal Nat. Genet. 22 (2), 199-202 (1999)
Title Structure and chromosomal assignment of the human S1-5 gene (FBNL) that is highly homologous to fibrillin .
Author Ikegawa S, Toda T, Okui K and Nakamura Y.
Journal Genomics 35 (3), 590-592 (1996)
Title Linkage of autosomal dominant radial drusen (malattia leventinese) to chromosome 2p16-21 .
Author Heon E, Piguet B, Munier F, Sneed SR, Morgan CM, Forni S, Pescia G, Schorderet D, Taylor CM, Streb LM, Wiles CD, Nishimura DY, Sheffield VC and Stone EM.
Journal Arch. Ophthalmol. 114 (2), 193-198 (1996)
Title An overexpressed gene transcript in senescent and quiescent human fibroblasts encoding a novel protein in the epidermal growth factor-like repeat family stimulates DNA synthesis .
Author Lecka-Czernik B, Lumpkin CK Jr and Goldstein S.
Journal Mol. Cell. Biol. 15 (1), 120-128 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.