• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19640 Homo sapiens cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu19640C Homo sapiens cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001039523.2, 189571658
Length 1449 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens cholinergic receptor, nicotinic, alpha 1 (muscle) (CHRNA1), transcript variant 1, mRNA.
Product acetylcholine receptor subunit alpha isoform a precursor
Comment

Summary: The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha subunits and 1 each of the beta, gamma, and delta subunits. This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Nov 2012].


Transcript Variant: This variant (1) represents the longer transcript, and encodes the longer isoform (a).

RefSeq NP_001034612.1
CDS 79..1527
Misc Feature(1)73..75
Misc Feature(2)88..1494
Misc Feature(3)148..846
Misc Feature(4)844..918
Misc Feature(5)865..1491
Misc Feature(6)940..996
Misc Feature(7)1042..1101
Misc Feature(8)1438..1494
Exon (1)1..121
Gene:CHRNA1
Gene Synonym:ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS
Exon (2)122..267
Gene:CHRNA1
Gene Synonym:ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS
Exon (3)268..312
Gene:CHRNA1
Gene Synonym:ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS
Exon (4)313..387
Gene:CHRNA1
Gene Synonym:ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS
Exon (5)388..497
Gene:CHRNA1
Gene Synonym:ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS
Exon (6)498..693
Gene:CHRNA1
Gene Synonym:ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS
Exon (7)694..931
Gene:CHRNA1
Gene Synonym:ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS
Exon (8)932..1155
Gene:CHRNA1
Gene Synonym:ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS
Exon (9)1156..1395
Gene:CHRNA1
Gene Synonym:ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS
Exon (10)1396..2059
Gene:CHRNA1
Gene Synonym:ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS
Translation MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL INVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHF PFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPD TPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKV FIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQ QG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(42)-dbSNP:
complement(42)-t, cdbSNP:182459320
complement(61)-g, adbSNP:375512537
complement(62)-t, gdbSNP:190007991
complement(71)-t, cdbSNP:138563328
complement(74)-t, adbSNP:377629045
complement(79)-t, cdbSNP:146464862
complement(92)-g, cdbSNP:185544602
complement(110)-t, cdbSNP:144897150
complement(130)-dbSNP:
complement(130)-g, cdbSNP:202221890
complement(142)-t, cdbSNP:368979094
complement(180)-t, gdbSNP:377254749
complement(207)-t, gdbSNP:140247604
complement(215)-t, cdbSNP:149851833
complement(255)-g, cdbSNP:199899006
complement(296)-dbSNP:
complement(296)-t, cdbSNP:141121555
complement(298)-t, cdbSNP:140059448
300+, gdbSNP:199470442
complement(302)-t, cdbSNP:147488907
complement(334)-dbSNP:
complement(334)-g, adbSNP:75536736
complement(355)-t, cdbSNP:146743352
complement(373)-t, gdbSNP:373012030
complement(384)-t, adbSNP:150585253
complement(406)-dbSNP:
complement(406)-g, adbSNP:377205515
complement(408)-t, gdbSNP:368009217
433+g, tdbSNP:199470444
complement(434..435)-, ccdbSNP:144488904
complement(472)-g, adbSNP:140268343
complement(473)-t, cdbSNP:376844505
complement(477)-t, gdbSNP:199555685
complement(525)-dbSNP:
complement(525)-t, cdbSNP:143047599
complement(603)-g, cdbSNP:200163630
complement(606)-g, adbSNP:372122272
607+c, gdbSNP:137852807
complement(611)-t, gdbSNP:374915730
complement(641)-g, cdbSNP:375645058
670+a, gdbSNP:137852801
complement(678)-g, adbSNP:186421442
679+a, gdbSNP:137852799
complement(692)-g, adbSNP:373561258
complement(693)-t, cdbSNP:370479041
complement(694)-dbSNP:
complement(694)-, cdbSNP:141198900
complement(700)-t, cdbSNP:145421881
complement(719)-t, cdbSNP:267599011
complement(733)-t, cdbSNP:201147926
complement(749)-t, cdbSNP:76911424
complement(766)-t, adbSNP:373958739
complement(774)-g, adbSNP:74533173
775+a, gdbSNP:199470445
complement(796)-t, cdbSNP:148304857
complement(808)-g, adbSNP:150638770
complement(810)-g, cdbSNP:375856493
complement(829)-t, cdbSNP:200102479
complement(832)-t, cdbSNP:111856577
839+g, tdbSNP:137852809
complement(858)-t, gdbSNP:143252724
864+c, gdbSNP:137852798
complement(876)-g, adbSNP:189442556
complement(903)-g, adbSNP:186607397
910+g, tdbSNP:137852805
complement(918)-t, cdbSNP:372014043
complement(933)-dbSNP:
complement(933)-t, cdbSNP:148502695
958+g, tdbSNP:137852803
complement(966)-t, cdbSNP:374093236
974+c, tdbSNP:137852800
979+c, tdbSNP:137852806
complement(1013)-g, cdbSNP:370345788
complement(1014)-t, cdbSNP:144020157
1019+g, tdbSNP:137852802
complement(1023)-g, adbSNP:142633480
complement(1045)-t, cdbSNP:201185358
complement(1065)-g, adbSNP:373005571
1066+a, gdbSNP:137852804
1078+a, cdbSNP:199470446
complement(1095)-g, adbSNP:200535960
complement(1098)-g, adbSNP:371524795
complement(1101)-t, gdbSNP:141733086
complement(1108)-g, adbSNP:150110639
1113+a, c, g, tdbSNP:2229957
complement(1113)-t, cdbSNP:386564491
complement(1150)-g, adbSNP:374391312
complement(1217)-dbSNP:
complement(1217)-t, cdbSNP:144533405
complement(1220)-t, gdbSNP:146863119
complement(1226)-t, adbSNP:6739001
complement(1241)-g, adbSNP:146771663
complement(1292)-g, adbSNP:149292107
complement(1294)-t, cdbSNP:199594911
complement(1314)-t, gdbSNP:200969433
complement(1315)-t, gdbSNP:202090282
complement(1323)-g, cdbSNP:141280544
complement(1352)-t, cdbSNP:137916282
complement(1369)-t, cdbSNP:376515416
complement(1386)-c, adbSNP:61737716
complement(1395)-c, adbSNP:199545638
complement(1397)-dbSNP:
complement(1397)-g, adbSNP:200394375
complement(1398)-t, cdbSNP:372181669
complement(1400)-g, adbSNP:367751078
1401+a, gdbSNP:17838545
complement(1401)-t, cdbSNP:386544703
complement(1408)-t, adbSNP:61731797
complement(1446)-g, adbSNP:146899588
complement(1447)-t, cdbSNP:151081792
1467+c, gdbSNP:137852808
complement(1486)-t, cdbSNP:372104868
complement(1502)-g, adbSNP:111396728
complement(1529)-t, gdbSNP:371042588
complement(1564)-g, adbSNP:371795389
complement(1567)-g, cdbSNP:367925483
complement(1629)-t, cdbSNP:376123739
complement(1741)-c, adbSNP:190389610
complement(1745)-g, adbSNP:79539026
complement(1912)-g, cdbSNP:4524097
complement(1949)-c, adbSNP:184095877
complement(1953)-t, gdbSNP:115375214
complement(1956)-, gdbSNP:376801487
Gene SymbolCHRNA1
Gene SynonymACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS
Chromosome2
Locus Map2q31.1
Title High expression of CHRNA1 is associated with reduced survival in early stage lung adenocarcinoma after complete resection .
Author Chang PM, Yeh YC, Chen TC, Wu YC, Lu PJ, Cheng HC, Lu HJ, Chen MH, Chou TY and Huang CY.
Journal Ann. Surg. Oncol. 20 (11), 3648-3654 (2013)
Title Clinical phenotype and the lack of mutations in the CHRNG, CHRND, and CHRNA1 genes in two Indian families with Escobar syndrome .
Author Kodaganur SG, Tontanahal SJ, Sarda A, Shah MH, Bhat V and Kumar A.
Journal Clin. Dysmorphol. 22 (2), 54-58 (2013)
Title Association study of nicotinic acetylcholine receptor genes identifies a novel lung cancer susceptibility locus near CHRNA1 in African-Americans .
Author Walsh KM, Amos CI, Wenzlaff AS, Gorlov IP, Sison JD, Wu X, Spitz MR, Hansen HM, Lu EY, Wei C, Zhang H, Chen W, Lloyd SM, Frazier ML, Bracci PM, Seldin MF, Wrensch MR, Schwartz AG and Wiencke JK.
Journal Oncotarget 3 (11), 1428-1438 (2012)
Title Myasthenic syndrome AChRalpha C-loop mutant disrupts initiation of channel gating .
Author Shen XM, Brengman JM, Sine SM and Engel AG.
Journal J. Clin. Invest. 122 (7), 2613-2621 (2012)
Title Nicotinic acetylcholine receptor alpha1 promotes calpain-1 activation and macrophage inflammation in hypercholesterolemic nephropathy .
Author Zhang G, Thomas AL, Marshall AL, Kernan KA, Su Y, Zheng Y, Takano J, Saido TC and Eddy AA.
Journal Lab. Invest. 91 (1), 106-123 (2011)
Title Congenital Myasthenic Syndromes .
Author Abicht,A., Muller,J. and Lochmuller,H.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Extracellular domains mediating epsilon subunit interactions of muscle acetylcholine receptor .
Author Yu XM and Hall ZW.
Journal Nature 352 (6330), 64-67 (1991)
Title Assignment of the human nicotinic acetylcholine receptor genes: the alpha and delta subunit genes to chromosome 2 and the beta subunit gene to chromosome 17 .
Author Beeson D, Jeremiah S, West LF, Povey S and Newsom-Davis J.
Journal Ann. Hum. Genet. 54 (PT 3), 199-208 (1990)
Title The human muscle nicotinic acetylcholine receptor alpha-subunit exist as two isoforms: a novel exon .
Author Beeson D, Morris A, Vincent A and Newsom-Davis J.
Journal EMBO J. 9 (7), 2101-2106 (1990)
Title Amphipathic segment of the nicotinic receptor alpha subunit contains epitopes recognized by T lymphocytes in myasthenia gravis .
Author Hohlfeld R, Toyka KV, Miner LL, Walgrave SL and Conti-Tronconi BM.
Journal J. Clin. Invest. 81 (3), 657-660 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.