• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001042 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_001042.2, 83722278
Length 3159 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), mRNA.
Product solute carrier family 2, facilitated glucose transporter member 4
Comment

Summary: This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq, Jul 2008].

RefSeq NP_001033.1
CDS 201..1730
Misc Feature(1)192..194
Misc Feature(2)219..239
Misc Feature(3)219..239
Misc Feature(4)273..335
Misc Feature(5)282..1649
Misc Feature(6)432..1541
Misc Feature(7)444..506
Misc Feature(8)order(453..455,462..467,474..476,486..491,495..500,
Misc Feature(9)534..596
Misc Feature(10)627..689
Misc Feature(11)714..776
Misc Feature(12)804..866
Misc Feature(13)1020..1022
Misc Feature(14)1062..1124
Misc Feature(15)1083..1091
Misc Feature(16)1170..1232
Misc Feature(17)1260..1322
Misc Feature(18)1353..1415
Misc Feature(19)1452..1514
Misc Feature(20)1536..1598
Misc Feature(21)1665..1670
Exon (1)1..233
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (2)234..350
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (3)351..523
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (4)524..648
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (5)649..764
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (6)765..927
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (7)928..1115
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (8)1116..1220
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (9)1221..1322
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (10)1323..1526
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (11)1527..3149
Gene:SLC2A4
Gene Synonym:GLUT4
Translation MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS AAFHRTPSLLEQEVKPSTELEYLGPDEND
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
9+dbSNP:
9+a, cdbSNP:5417
16+a, gdbSNP:9282855
22..23+, cdbSNP:35035718
37+a, gdbSNP:112476696
39+a, gdbSNP:5418
60+c, gdbSNP:5419
68+a, gdbSNP:5420
84+a, gdbSNP:370558824
114+g, tdbSNP:45599134
120+a, cdbSNP:186924344
168+c, tdbSNP:368253548
180+a, gdbSNP:72556569
184+a, cdbSNP:375240848
255+dbSNP:
255+c, gdbSNP:139011011
266+a, gdbSNP:142195514
272+a, gdbSNP:192326501
273+g, tdbSNP:143506382
304+c, tdbSNP:376636615
332+c, tdbSNP:147146068
complement(365)-dbSNP:
complement(365)-t, gdbSNP:35198331
386+a, gdbSNP:143739087
403+g, tdbSNP:144936940
433+c, gdbSNP:5434
436+c, gdbSNP:8192703
440+c, tdbSNP:370552867
452+c, tdbSNP:374445237
519+g, tdbSNP:77409522
536+dbSNP:
536+a, gdbSNP:372343392
552+c, tdbSNP:139410029
556+c, tdbSNP:150043620
557+a, gdbSNP:375581164
575+c, tdbSNP:201117558
590+c, tdbSNP:5435
597+c, gdbSNP:149169715
622+c, gdbSNP:369328286
655+dbSNP:
655+c, tdbSNP:143663296
677+c, tdbSNP:375406466
678+a, gdbSNP:377371372
679+c, tdbSNP:201532628
694+a, cdbSNP:369638698
706+a, gdbSNP:146787418
709+a, gdbSNP:140466829
713+c, tdbSNP:200313495
745+c, tdbSNP:373418978
758+c, tdbSNP:145632483
790..791+dbSNP:
790..791+, cdbSNP:146262640
851+a, gdbSNP:374995843
864+a, tdbSNP:371607018
872+c, tdbSNP:72556546
875+g, tdbSNP:150621510
909+a, gdbSNP:202200041
911+a, gdbSNP:200489077
994+dbSNP:
994+a, gdbSNP:200597421
1006+a, gdbSNP:148284992
1020+g, tdbSNP:13306763
1053+c, tdbSNP:140743598
1054+a, gdbSNP:150359014
1059+c, tdbSNP:138015791
1065+a, gdbSNP:367726675
1066+c, tdbSNP:202163530
1073+a, gdbSNP:377321536
1133+dbSNP:
1133+c, tdbSNP:72556547
1142+c, tdbSNP:143529618
1156+a, tdbSNP:147155858
1159+c, gdbSNP:200526268
1196+c, tdbSNP:368302808
1237+dbSNP:
1237+a, gdbSNP:138717844
1240+c, tdbSNP:370389410
1241+a, gdbSNP:374828098
1246+a, gdbSNP:142724012
1248+c, tdbSNP:144431498
1253+a, gdbSNP:148595409
1254+c, tdbSNP:367617703
1273+c, tdbSNP:8192702
1280+a, gdbSNP:374977011
1290+a, gdbSNP:199806410
1298+a, gdbSNP:150672037
1333+dbSNP:
1333+c, tdbSNP:140103673
1347+a, gdbSNP:121434581
1359+a, gdbSNP:146828718
1373+c, tdbSNP:376202095
1419+a, gdbSNP:375714683
1427+g, tdbSNP:140608377
1447+a, gdbSNP:144216820
1469..1470+, gdbSNP:138107432
1481+c, tdbSNP:375934415
1487+a, gdbSNP:370002371
1528+dbSNP:
1528+a, cdbSNP:113558950
1530+a, gdbSNP:145180015
1543+a, gdbSNP:201686153
1544+c, tdbSNP:374081954
1571+c, gdbSNP:148907023
1572+c, tdbSNP:367632254
1574+a, gdbSNP:146879129
1620+c, tdbSNP:200651340
1621+a, gdbSNP:70937028
1725+a, gdbSNP:371314573
1764+c, gdbSNP:375887114
1765+c, tdbSNP:368421748
1768+c, gdbSNP:371918264
1770+a, gdbSNP:372752917
1793..1794+, cdbSNP:5819152
1848+a, gdbSNP:112694369
1908+c, tdbSNP:72556549
1972..1973+, cdbSNP:35584159
2036+a, cdbSNP:78907614
2217+g, tdbSNP:8082645
2217+, tdbSNP:35240617
2220+c, tdbSNP:70937029
2222+c, tdbSNP:55782239
2245+, tdbSNP:398030257
2274+c, gdbSNP:188617633
2275+a, gdbSNP:150460962
2286+c, tdbSNP:181568851
2288+c, tdbSNP:5422
2324+c, tdbSNP:5423
2344+c, tdbSNP:71370490
2360+a, tdbSNP:369254481
2369+a, gdbSNP:5424
2371+a, cdbSNP:5425
2381+a, gdbSNP:5426
2394+a, tdbSNP:5427
2416+a, gdbSNP:185947659
2427+a, gdbSNP:5428
2432+a, gdbSNP:5429
2437+a, gdbSNP:151209520
2438+a, gdbSNP:5430
2460+c, tdbSNP:5431
2502+a, gdbSNP:5432
2523+c, tdbSNP:375818471
2623+a, cdbSNP:5433
2644+c, tdbSNP:80094330
2843+c, tdbSNP:9894700
2844+a, gdbSNP:377568297
2846+c, tdbSNP:189275417
2894..2895+, tadbSNP:201992080
3073+c, tdbSNP:11650712
3127+a, gdbSNP:138258204
3132+a, gdbSNP:373162837
Gene SymbolSLC2A4
Gene SynonymGLUT4
Chromosome17
Locus Map17p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001042 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), mRNA. In-stock $509.00 $460.00 12
Title Functional roles of BCAR3 in the signaling pathways of insulin leading to DNA synthesis, membrane ruffling and GLUT4 translocation .
Author Oh MJ, Yi SJ, Kim HS, Kim JH, Jeong YH, van Agthoven T and Jhun BH.
Journal Biochem. Biophys. Res. Commun. 441 (4), 911-916 (2013)
Title Exercise training favors increased insulin-stimulated glucose uptake in skeletal muscle in contrast to adipose tissue: a randomized study using FDG PET imaging .
Author Reichkendler MH, Auerbach P, Rosenkilde M, Christensen AN, Holm S, Petersen MB, Lagerberg A, Larsson HB, Rostrup E, Mosbech TH, Sjodin A, Kjaer A, Ploug T, Hoejgaard L and Stallknecht B.
Journal Am. J. Physiol. Endocrinol. Metab. 305 (4), E496-E506 (2013)
Title SLC2A4gene: a promising target for pharmacogenomics of insulin resistance .
Author Correa-Giannella,M.L. and Machado,U.F.
Journal Pharmacogenomics 14 (8), 847-850 (2013)
Title 17beta-estradiol activates glucose uptake via GLUT4 translocation and PI3K/Akt signaling pathway in MCF-7 cells .
Author Garrido P, Moran J, Alonso A, Gonzalez S and Gonzalez C.
Journal Endocrinology 154 (6), 1979-1989 (2013)
Title Critical illness myopathy and GLUT4: significance of insulin and muscle contraction .
Author Weber-Carstens S, Schneider J, Wollersheim T, Assmann A, Bierbrauer J, Marg A, Al Hasani H, Chadt A, Wenzel K, Koch S, Fielitz J, Kleber C, Faust K, Mai K, Spies CD, Luft FC, Boschmann M, Spranger
Journal Am. J. Respir. Crit. Care Med. 187 (4), 387-396 (2013)
Title Human GLUT4/muscle-fat glucose-transporter gene. Characterization and genetic variation .
Author Buse JB, Yasuda K, Lay TP, Seo TS, Olson AL, Pessin JE, Karam JH, Seino S and Bell GI.
Journal Diabetes 41 (11), 1436-1445 (1992)
Title Expression and regulation of the human GLUT4/muscle-fat facilitative glucose transporter gene in transgenic mice .
Author Liu ML, Olson AL, Moye-Rowley WS, Buse JB, Bell GI and Pessin JE.
Journal J. Biol. Chem. 267 (17), 11673-11676 (1992)
Title Insulin receptor and insulin-responsive glucose transporter (GLUT 4) mutations and polymorphisms in a Welsh type 2 (non-insulin-dependent) diabetic population .
Author O'Rahilly S, Krook A, Morgan R, Rees A, Flier JS and Moller DE.
Journal Diabetologia 35 (5), 486-489 (1992)
Title Molecular scanning of insulin-responsive glucose transporter (GLUT4) gene in NIDDM subjects .
Author Choi WH, O'Rahilly S, Buse JB, Rees A, Morgan R, Flier JS and Moller DE.
Journal Diabetes 40 (12), 1712-1718 (1991)
Title Analysis of the gene sequences of the insulin receptor and the insulin-sensitive glucose transporter (GLUT-4) in patients with common-type non-insulin-dependent diabetes mellitus .
Author Kusari J, Verma US, Buse JB, Henry RR and Olefsky JM.
Journal J. Clin. Invest. 88 (4), 1323-1330 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.