Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), mRNA.
| RefSeq Version | NM_001042.2, 83722278 |
| Length | 3159 bp |
| Structure | linear |
| Update Date | 13-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), mRNA. |
| Product | solute carrier family 2, facilitated glucose transporter member 4 |
| Comment | Summary: This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq]. |
| RefSeq | NP_001033.1 |
| CDS | 201..1730 | Exon (1) | 1..233 | Exon (2) | 1..233 | Exon (3) | 234..350 | Exon (4) | 351..523 | Exon (5) | 524..648 | Exon (6) | 649..764 | Exon (7) | 765..927 | Exon (8) | 928..1115 | Exon (9) | 1116..1220 | Exon (10) | 1221..1322 | Exon (11) | 1323..1526 | Exon (12) | 1527..3149 |
| Translation | MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA
RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS
AAFHRTPSLLEQEVKPSTELEYLGPDEND
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Title | Human cytomegalovirus activates glucose transporter 4 expression to increase glucose uptake during infection . |
| Author | Yu,Y., Maguire,T.G. and Alwine,J.C. |
| Journal | J. Virol. 85 (4), 1573-1580 (2011) |
| Title | Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC) . |
| Author | Campa,D., Husing,A., Chang-Claude,J., Dostal,L., Boeing,H., Kroger,J., Tjonneland,A., Roswall,N., Overvad,K., Dahm,C.C., Rodriguez,L., Sala,N., Perez,M.J., Larranaga,N., Chirlaque,M.D., Ardanaz,E., Khaw,K.T., Wareham,N., Allen,N.E., Travis,R.C., Trichopoulou,A., Naska,A., Bamia,C., Palli,D., Sieri,S., Tumino,R., Sacerdote,C., van Kranen,H.J., Bas Bueno-de-Mesquita,H., Stattin,P., Johansson,M., Chajes,V., Rinaldi,S., Romieu,I., Siddiq,A., Norat,T., Riboli,E., Kaaks,R. and Canzian,F. |
| Journal | Eur. J. Cancer 47 (3), 420-427 (2011) |
| Title | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study . |
| Author | Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S. |
| Journal | Diabetes Care 33 (10), 2250-2253 (2010) |
| Title | Measuring GLUT4 translocation in mature muscle fibers . |
| Author | Lauritzen,H.P. and Schertzer,J.D. |
| Journal | Am. J. Physiol. Endocrinol. Metab. 299 (2), E169-E179 (2010) |
| Title | Case-control analysis of SNPs in GLUT4, RBP4 and STRA6: association of SNPs in STRA6 with type 2 diabetes in a South Indian population . |
| Author | Nair,A.K., Sugunan,D., Kumar,H. and Anilkumar,G. |
| Journal | PLoS ONE 5 (7), E11444 (2010) |
| Title | Human GLUT4/muscle-fat glucose-transporter gene. Characterization and genetic variation . |
| Author | Buse,J.B., Yasuda,K., Lay,T.P., Seo,T.S., Olson,A.L., Pessin,J.E., Karam,J.H., Seino,S. and Bell,G.I. |
| Journal | Diabetes 41 (11), 1436-1445 (1992) |
| Title | Expression and regulation of the human GLUT4/muscle-fat facilitative glucose transporter gene in transgenic mice . |
| Author | Liu,M.L., Olson,A.L., Moye-Rowley,W.S., Buse,J.B., Bell,G.I. and Pessin,J.E. |
| Journal | J. Biol. Chem. 267 (17), 11673-11676 (1992) |
| Title | Insulin receptor and insulin-responsive glucose transporter (GLUT 4) mutations and polymorphisms in a Welsh type 2 (non-insulin-dependent) diabetic population . |
| Author | O'Rahilly,S., Krook,A., Morgan,R., Rees,A., Flier,J.S. and Moller,D.E. |
| Journal | Diabetologia 35 (5), 486-489 (1992) |
| Title | Molecular scanning of insulin-responsive glucose transporter (GLUT4) gene in NIDDM subjects . |
| Author | Choi,W.H., O'Rahilly,S., Buse,J.B., Rees,A., Morgan,R., Flier,J.S. and Moller,D.E. |
| Journal | Diabetes 40 (12), 1712-1718 (1991) |
| Title | Analysis of the gene sequences of the insulin receptor and the insulin-sensitive glucose transporter (GLUT-4) in patients with common-type non-insulin-dependent diabetes mellitus . |
| Author | Kusari,J., Verma,U.S., Buse,J.B., Henry,R.R. and Olefsky,J.M. |
| Journal | J. Clin. Invest. 88 (4), 1323-1330 (1991) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |