• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), mRNA.


RefSeq Accession Definition Services Price Order
NM_001042 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), mRNA. ORF Sequence $443.70
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001042.2, 83722278
Length 3159 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), mRNA.
Product solute carrier family 2, facilitated glucose transporter member 4
Comment

Summary: This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq, Jul 2008].

RefSeq NP_001033.1
CDS 201..1730
Misc Feature(1)192..194
Misc Feature(2)219..239
Misc Feature(3)219..239
Misc Feature(4)273..335
Misc Feature(5)282..1649
Misc Feature(6)432..>773
Misc Feature(7)444..506
Misc Feature(8)534..596
Misc Feature(9)627..689
Misc Feature(10)714..776
Misc Feature(11)804..866
Misc Feature(12)1020..1022
Misc Feature(13)<1059..1547
Misc Feature(14)1062..1124
Misc Feature(15)1083..1091
Misc Feature(16)1170..1232
Misc Feature(17)1260..1322
Misc Feature(18)1353..1415
Misc Feature(19)1452..1514
Misc Feature(20)1536..1598
Misc Feature(21)1665..1670
Exon (1)1..233
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (2)234..350
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (3)351..523
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (4)524..648
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (5)649..764
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (6)765..927
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (7)928..1115
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (8)1116..1220
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (9)1221..1322
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (10)1323..1526
Gene:SLC2A4
Gene Synonym:GLUT4
Exon (11)1527..3149
Gene:SLC2A4
Gene Synonym:GLUT4
Translation MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS AAFHRTPSLLEQEVKPSTELEYLGPDEND
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
9+dbSNP:
9+a, cdbSNP:5417
16+a, gdbSNP:9282855
22..23+, cdbSNP:35035718
37+a, gdbSNP:112476696
39+a, gdbSNP:5418
60+c, gdbSNP:5419
68+a, gdbSNP:5420
114+g, tdbSNP:45599134
120+a, cdbSNP:186924344
180+a, gdbSNP:72556569
255+dbSNP:
255+c, gdbSNP:139011011
266+a, gdbSNP:142195514
272+a, gdbSNP:192326501
273+g, tdbSNP:143506382
332+c, tdbSNP:147146068
365+dbSNP:
365+g, tdbSNP:35198331
386+a, gdbSNP:143739087
403+g, tdbSNP:144936940
433+c, gdbSNP:5434
436+c, gdbSNP:8192703
519+g, tdbSNP:77409522
552+dbSNP:
552+c, tdbSNP:139410029
556+c, tdbSNP:150043620
575+c, tdbSNP:201117558
590+c, tdbSNP:5435
597+c, gdbSNP:149169715
655+dbSNP:
655+c, tdbSNP:143663296
679+c, tdbSNP:201532628
706+a, gdbSNP:146787418
709+a, gdbSNP:140466829
713+c, tdbSNP:200313495
758+c, tdbSNP:145632483
790..791+dbSNP:
790..791+, cdbSNP:146262640
872+c, tdbSNP:72556546
875+g, tdbSNP:150621510
909+a, gdbSNP:202200041
911+a, gdbSNP:200489077
994+dbSNP:
994+a, gdbSNP:200597421
1006+a, gdbSNP:148284992
1020+g, tdbSNP:13306763
1053+c, tdbSNP:140743598
1054+a, gdbSNP:150359014
1059+c, tdbSNP:138015791
1066+c, tdbSNP:202163530
1133+dbSNP:
1133+c, tdbSNP:72556547
1142+c, tdbSNP:143529618
1156+a, tdbSNP:147155858
1159+c, gdbSNP:200526268
1237+dbSNP:
1237+a, gdbSNP:138717844
1246+a, gdbSNP:142724012
1248+c, tdbSNP:144431498
1253+a, gdbSNP:148595409
1273+c, tdbSNP:8192702
1290+a, gdbSNP:199806410
1298+a, gdbSNP:150672037
1333+dbSNP:
1333+c, tdbSNP:140103673
1347+a, gdbSNP:121434581
1359+a, gdbSNP:146828718
1427+g, tdbSNP:140608377
1447+a, gdbSNP:144216820
1469..1470+, gdbSNP:138107432
1528+dbSNP:
1528+a, cdbSNP:113558950
1530+a, gdbSNP:145180015
1543+a, gdbSNP:201686153
1571+c, gdbSNP:148907023
1574+a, gdbSNP:146879129
1620+c, tdbSNP:200651340
1621+a, gdbSNP:70937028
1791..1792+, cdbSNP:5819152
1848+a, gdbSNP:112694369
1908+c, tdbSNP:72556549
1971..1972+, cdbSNP:35584159
2036+a, cdbSNP:78907614
2217+g, tdbSNP:8082645
2217+, t, ttttdbSNP:35240617
2220+c, tdbSNP:70937029
2222+c, tdbSNP:55782239
2274+c, gdbSNP:188617633
2275+a, gdbSNP:150460962
2286+c, tdbSNP:181568851
2288+c, tdbSNP:5422
2324+c, tdbSNP:5423
2344+c, tdbSNP:71370490
2369+a, gdbSNP:5424
2371+a, cdbSNP:5425
2381+a, gdbSNP:5426
2394+a, tdbSNP:5427
2416+a, gdbSNP:185947659
2427+a, gdbSNP:5428
2432+a, gdbSNP:5429
2437+a, gdbSNP:151209520
2438+a, gdbSNP:5430
2460+c, tdbSNP:5431
2502+a, gdbSNP:5432
2623+a, cdbSNP:5433
2644+c, tdbSNP:80094330
2843+c, tdbSNP:9894700
2846+c, tdbSNP:189275417
2894..2895+, tadbSNP:201992080
3073+c, tdbSNP:11650712
3127+a, gdbSNP:138258204
Gene SymbolSLC2A4
Gene SynonymGLUT4
Chromosome17
Locus Map17p13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001042 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), mRNA. Full Length $1105.65
ORF Sequence $443.70
Title Critical illness myopathy and GLUT4: significance of insulin and muscle contraction .
Author Weber-Carstens,S., Schneider,J., Wollersheim,T., Assmann,A., Bierbrauer,J., Marg,A., Al Hasani,H., Chadt,A., Wenzel,K., Koch,S., Fielitz,J., Kleber,C., Faust,K., Mai,K., Spies,C.D., Luft,F.C., Boschmann,M., Spranger,J. and Spuler,S.
Journal Am. J. Respir. Crit. Care Med. 187 (4), 387-396 (2013)
Title Identification of a role for CLASP2 in insulin action .
Author Langlais,P., Dillon,J.L., Mengos,A., Baluch,D.P., Ardebili,R., Miranda,D.N., Xie,X., Heckmann,B.L., Liu,J. and Mandarino,L.J.
Journal J. Biol. Chem. 287 (46), 39245-39253 (2012)
Title Association of GLUT4 gene variants with HbA1c level in Japanese men .
Author Xi,C., Miyaki,K., Ikeda,S., Song,Y., Sinbo,T. and Muramatsu,M.
Journal Endocr. J. 59 (8), 677-684 (2012)
Title The role of CaMKII in regulating GLUT4 expression in skeletal muscle .
Author Ojuka,E.O., Goyaram,V. and Smith,J.A.
Journal Am. J. Physiol. Endocrinol. Metab. 303 (3), E322-E331 (2012)
Title Triiodothyronine acutely stimulates glucose transport into L6 muscle cells without increasing surface GLUT4, GLUT1, or GLUT3 .
Author Teixeira,S.S., Tamrakar,A.K., Goulart-Silva,F., Serrano-Nascimento,C., Klip,A. and Nunes,M.T.
Journal Thyroid 22 (7), 747-754 (2012)
Title Human GLUT4/muscle-fat glucose-transporter gene. Characterization and genetic variation .
Author Buse,J.B., Yasuda,K., Lay,T.P., Seo,T.S., Olson,A.L., Pessin,J.E., Karam,J.H., Seino,S. and Bell,G.I.
Journal Diabetes 41 (11), 1436-1445 (1992)
Title Expression and regulation of the human GLUT4/muscle-fat facilitative glucose transporter gene in transgenic mice .
Author Liu,M.L., Olson,A.L., Moye-Rowley,W.S., Buse,J.B., Bell,G.I. and Pessin,J.E.
Journal J. Biol. Chem. 267 (17), 11673-11676 (1992)
Title Insulin receptor and insulin-responsive glucose transporter (GLUT 4) mutations and polymorphisms in a Welsh type 2 (non-insulin-dependent) diabetic population .
Author O'Rahilly,S., Krook,A., Morgan,R., Rees,A., Flier,J.S. and Moller,D.E.
Journal Diabetologia 35 (5), 486-489 (1992)
Title Molecular scanning of insulin-responsive glucose transporter (GLUT4) gene in NIDDM subjects .
Author Choi,W.H., O'Rahilly,S., Buse,J.B., Rees,A., Morgan,R., Flier,J.S. and Moller,D.E.
Journal Diabetes 40 (12), 1712-1718 (1991)
Title Analysis of the gene sequences of the insulin receptor and the insulin-sensitive glucose transporter (GLUT-4) in patients with common-type non-insulin-dependent diabetes mellitus .
Author Kusari,J., Verma,U.S., Buse,J.B., Henry,R.R. and Olefsky,J.M.
Journal J. Clin. Invest. 88 (4), 1323-1330 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878