• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19055 Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19055C Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001066.2, 23312365
Length 1386 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA.
Product tumor necrosis factor receptor superfamily member 1B precursor
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. [provided by RefSeq, Jul 2008].

RefSeq NP_001057.1
CDS 90..1475
Misc Feature(1)204..317
Misc Feature(2)207..512
Misc Feature(3)order(207..212,336..338,369..371,399..401,465..467,
Misc Feature(4)order(219..221,252..254,264..266,270..272,309..311,
Misc Feature(5)order(252..281,306..320,420..428)
Misc Feature(6)318..443
Misc Feature(7)order(345..350,366..374)
Misc Feature(8)444..575
Misc Feature(9)order(465..467,498..512)
Misc Feature(10)513..>689
Misc Feature(11)order(513..539,564..578,666..674)
Misc Feature(12)order(522..524,528..530,567..569,576..578,606..608)
Misc Feature(13)576..692
Misc Feature(14)order(603..608,624..632)
Misc Feature(15)861..950
Misc Feature(16)1395..1397
Exon (1)1..167
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (2)168..267
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (3)268..396
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (4)397..546
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (5)547..640
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (6)641..876
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (7)877..954
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (8)955..989
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (9)990..1194
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (10)1195..3675
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Translation MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
6+dbSNP:
6+a, cdbSNP:375496944
15+g, tdbSNP:5745949
31+c, tdbSNP:5745950
61..62+, gcgagggcdbSNP:5745951
120+a, gdbSNP:113538181
172+dbSNP:
172+c, tdbSNP:142907823
178+c, tdbSNP:183755458
191+a, gdbSNP:373387104
197+c, tdbSNP:377349339
complement(257)-t, cdbSNP:945439
262+c, tdbSNP:139221787
263+a, gdbSNP:149960043
265+c, tdbSNP:140531887
299+dbSNP:
299+c, tdbSNP:147703074
395+c, tdbSNP:142297196
425+dbSNP:
425+c, gdbSNP:150483691
468+g, tdbSNP:138462821
469+c, tdbSNP:375442414
506+c, gdbSNP:145097690
515+c, gdbSNP:201949042
576+dbSNP:
576+c, gdbSNP:373216188
592+c, tdbSNP:201574750
605+a, gdbSNP:141628211
617+a, gdbSNP:377401769
632+c, tdbSNP:2275415
648+dbSNP:
648+a, gdbSNP:2228494
654+a, gdbSNP:200254914
676+g, tdbSNP:1061622
697+c, tdbSNP:199873050
702+c, gdbSNP:201545665
708+c, tdbSNP:140857317
760+c, gdbSNP:145736387
783+a, gdbSNP:5746026
795+a, gdbSNP:5746027
805+c, tdbSNP:150329910
809+c, tdbSNP:267597960
822+a, gdbSNP:375948624
857+c, tdbSNP:146983380
864+a, gdbSNP:199974127
880+dbSNP:
880+c, tdbSNP:2229700
894+a, cdbSNP:17879042
909+c, tdbSNP:61761336
944+a, cdbSNP:201648206
948+c, gdbSNP:192393562
973+dbSNP:
973+a, gdbSNP:5746032
991+dbSNP:
991+c, gdbSNP:17883432
1004+c, tdbSNP:369209421
1008+a, gdbSNP:199931640
1018+g, tdbSNP:373401765
1031+c, tdbSNP:375369071
1042+a, cdbSNP:116544657
1058+a, gdbSNP:77990239
1061+c, gdbSNP:201872077
1076+c, tdbSNP:368749492
1091+c, gdbSNP:372975213
1123+a, gdbSNP:377693214
1146+a, gdbSNP:112914333
1171+c, tdbSNP:372228157
1174+a, gdbSNP:369918901
1198+dbSNP:
1198+c, tdbSNP:75299314
1213+a, gdbSNP:55925819
1273+c, tdbSNP:370414826
1281+c, tdbSNP:142879753
1291+c, gdbSNP:376576479
1325+c, gdbSNP:139665575
1343+c, tdbSNP:150855008
1357+c, tdbSNP:370292777
1364+a, gdbSNP:149512902
1381+a, gdbSNP:373722040
1397+a, gdbSNP:368698604
1410+a, cdbSNP:200600328
1425+g, tdbSNP:371439340
1444+c, gdbSNP:200538351
1461+a, cdbSNP:375627878
1482+c, tdbSNP:368365494
1483+a, gdbSNP:371983819
1495+g, tdbSNP:199689616
1497+c, tdbSNP:150675043
1498+a, gdbSNP:368107139
1500+a, gdbSNP:371676482
1514+a, gdbSNP:201385323
1517+c, tdbSNP:374945013
1537+a, gdbSNP:370508215
1595+c, tdbSNP:186736505
1613+c, tdbSNP:200873417
1613+c, tdbSNP:386438684
1650+a, tdbSNP:374272314
1662+a, gdbSNP:368441565
1663+a, gdbSNP:1061624
1668+g, tdbSNP:5030792
1690+c, tdbSNP:3397
1723+c, tdbSNP:114236595
1785+g, tdbSNP:368738070
1845..1846+, gtttdbSNP:5746064
1862+a, cdbSNP:5746065
1900+c, tdbSNP:10157774
1928+a, gdbSNP:5746066
1947+c, tdbSNP:5746067
1953+c, gdbSNP:5746068
1971+c, tdbSNP:367861844
1996+c, tdbSNP:17880792
2029+a, gdbSNP:191982398
complement(2049)-g, adbSNP:17881445
2082+a, gdbSNP:370156484
2104+c, tdbSNP:17880332
2135+c, tdbSNP:5746069
2136+g, tdbSNP:187438259
2234+a, gdbSNP:372210559
2241+c, tdbSNP:377063779
2248+c, tdbSNP:189604514
2297+a, gdbSNP:182211706
2312+c, tdbSNP:186856234
2313+c, gdbSNP:5746070
2339..2340+, gdbSNP:71568396
2349+a, cdbSNP:374205228
2369..2370+, adbSNP:55651536
2379..2380+, adbSNP:397793997
2397+c, tdbSNP:1061628
2421..2422+, tgaadbSNP:5746071
2422..2423+, tgaadbSNP:373828938
2425..2426+, tgaadbSNP:397763278
2452+a, gdbSNP:369926083
2464+c, tdbSNP:139456075
2555+c, tdbSNP:6668561
2583+c, tdbSNP:77552668
2607+c, tdbSNP:61774891
2623+c, tdbSNP:113401157
2652+c, tdbSNP:5746072
2660+c, gdbSNP:183385861
2740+c, tdbSNP:11807940
2784+c, tdbSNP:117721591
2785+c, tdbSNP:17880872
2786+a, cdbSNP:17881461
2830+a, gdbSNP:148699600
2893+c, tdbSNP:13306717
2897+a, gdbSNP:1061631
2932+a, gdbSNP:376320857
2969+a, gdbSNP:1800621
2976+g, tdbSNP:17884182
2995+g, tdbSNP:113865581
3028+a, c, gdbSNP:1061642
3035+c, tdbSNP:5746073
3119+a, gdbSNP:5746074
3217+, adbSNP:370853008
3235+a, gdbSNP:5746075
3392+a, cdbSNP:191275160
3546+a, gdbSNP:183757270
3589..3590+, tgdbSNP:137939745
Gene SymbolTNFRSF1B
Gene SynonymCD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Chromosome1
Locus Map1p36.22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001066 Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA. In-stock $99.00 5-7
Title TNF receptor 2 protects oligodendrocyte progenitor cells against oxidative stress .
Author Maier O, Fischer R, Agresti C and Pfizenmaier K.
Journal Biochem. Biophys. Res. Commun. 440 (2), 336-341 (2013)
Title Impaired Th1 immunity in ovarian cancer patients is mediated by TNFR2+ Tregs within the tumor microenvironment .
Author Govindaraj C, Scalzo-Inguanti K, Madondo M, Hallo J, Flanagan K, Quinn M and Plebanski M.
Journal Clin. Immunol. 149 (1), 97-110 (2013)
Title Amyloid beta(1)(-)(4)(2) (Abeta(4)(2)) up-regulates the expression of sortilin via the p75(NTR)/RhoA signaling pathway .
Author Saadipour K, Yang M, Lim Y, Georgiou K, Sun Y, Keating D, Liu J, Wang YR, Gai WP, Zhong JH, Wang YJ and Zhou XF.
Journal J. Neurochem. 127 (2), 152-162 (2013)
Title Maternal tumor necrosis factor receptor 2 gene variants associated with pre-eclampsia in Tunisian women .
Author Said L, Faleh R, Smida S, Laajili H, Sakouhi M and Bel Hadj Jrad B.
Journal J. Obstet. Gynaecol. Res. 39 (8), 1301-1307 (2013)
Title Release of nonmuscle myosin II from the cytosolic domain of tumor necrosis factor receptor 2 is required for target gene expression .
Author Chandrasekharan UM, Dechert L, Davidson UI, Waitkus M, Mavrakis L, Lyons K, Beach JR, Li X, Egelhoff TT, Fox PL and DiCorleto PE.
Journal Sci Signal 6 (284), RA60 (2013)
Title Down-modulation of cell surface expression of p80 form of the tumor necrosis factor receptor by human immunodeficiency virus-1 tat gene .
Author Pocsik E, Higuchi M and Aggarwal BB.
Journal Lymphokine Cytokine Res. 11 (6), 317-325 (1992)
Title Biochemical properties of the 75-kDa tumor necrosis factor receptor. Characterization of ligand binding, internalization, and receptor phosphorylation .
Author Pennica D, Lam VT, Mize NK, Weber RF, Lewis M, Fendly BM, Lipari MT and Goeddel DV.
Journal J. Biol. Chem. 267 (29), 21172-21178 (1992)
Title Tumour necrosis factor receptor distribution in human lymphoid tissue .
Author Ryffel B, Brockhaus M, Greiner B, Mihatsch MJ and Gudat F.
Journal Immunology 74 (3), 446-452 (1991)
Title The gene for the type II (p75) tumor necrosis factor receptor (TNF-RII) is localized on band 1p36.2-p36.3 .
Author Kemper O, Derre J, Cherif D, Engelmann H, Wallach D and Berger R.
Journal Hum. Genet. 87 (5), 623-624 (1991)
Title [Gastroduodenal reflux and non-ulcerous dyspepsia. Is it an accidental association?] .
Author Bost R and Hostein J.
Journal Ann Gastroenterol Hepatol (Paris) 27 (4), 191-192 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.