• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001066 Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_001066.2, 23312365
Length 3682 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA.
Product tumor necrosis factor receptor superfamily member 1B precursor
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. [provided by RefSeq, Jul 2008].

RefSeq NP_001057.1
CDS 90..1475
Misc Feature(1)204..317
Misc Feature(2)207..512
Misc Feature(3)order(207..212,336..338,369..371,399..401,465..467,
Misc Feature(4)order(219..221,252..254,264..266,270..272,309..311,
Misc Feature(5)order(252..281,306..320,420..428)
Misc Feature(6)318..443
Misc Feature(7)order(345..350,366..374)
Misc Feature(8)444..575
Misc Feature(9)order(465..467,498..512)
Misc Feature(10)513..>689
Misc Feature(11)order(513..539,564..578,666..674)
Misc Feature(12)order(522..524,528..530,567..569,576..578,606..608)
Misc Feature(13)576..692
Misc Feature(14)order(603..608,624..632)
Misc Feature(15)861..950
Misc Feature(16)1395..1397
Exon (1)1..167
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (2)168..267
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (3)268..396
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (4)397..546
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (5)547..640
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (6)641..876
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (7)877..954
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (8)955..989
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (9)990..1194
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Exon (10)1195..3675
Gene:TNFRSF1B
Gene Synonym:CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Translation MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
15+dbSNP:
15+g, tdbSNP:5745949
31+c, tdbSNP:5745950
61..62+, gcgagggcdbSNP:5745951
120+a, gdbSNP:113538181
172+dbSNP:
172+c, tdbSNP:142907823
178+c, tdbSNP:183755458
257+c, tdbSNP:945439
262+c, tdbSNP:139221787
263+a, gdbSNP:149960043
265+c, tdbSNP:140531887
299+dbSNP:
299+c, tdbSNP:147703074
395+c, tdbSNP:142297196
425+dbSNP:
425+c, gdbSNP:150483691
468+g, tdbSNP:138462821
506+c, gdbSNP:145097690
515+c, gdbSNP:201949042
592+dbSNP:
592+c, tdbSNP:201574750
605+a, gdbSNP:141628211
632+c, tdbSNP:2275415
648+dbSNP:
648+a, gdbSNP:2228494
654+a, gdbSNP:200254914
676+g, tdbSNP:1061622
697+c, tdbSNP:199873050
702+c, gdbSNP:201545665
708+c, tdbSNP:140857317
760+c, gdbSNP:145736387
783+a, gdbSNP:5746026
795+a, gdbSNP:5746027
805+c, tdbSNP:150329910
857+c, tdbSNP:146983380
864+a, gdbSNP:199974127
880+dbSNP:
880+c, tdbSNP:2229700
894+a, cdbSNP:17879042
909+c, tdbSNP:61761336
944+a, cdbSNP:201648206
948+c, gdbSNP:192393562
973+dbSNP:
973+a, gdbSNP:5746032
991+dbSNP:
991+c, gdbSNP:17883432
1008+a, gdbSNP:199931640
1042+a, cdbSNP:116544657
1058+a, gdbSNP:77990239
1061+c, gdbSNP:201872077
1146+a, gdbSNP:112914333
1198+dbSNP:
1198+c, tdbSNP:75299314
1213+a, gdbSNP:55925819
1281+c, tdbSNP:142879753
1325+c, gdbSNP:139665575
1343+c, tdbSNP:150855008
1364+a, gdbSNP:149512902
1410+a, cdbSNP:200600328
1444+c, gdbSNP:200538351
1495+g, tdbSNP:199689616
1497+c, tdbSNP:150675043
1514+a, gdbSNP:201385323
1595+c, tdbSNP:186736505
1613+c, tdbSNP:200873417
1663+a, gdbSNP:1061624
1668+g, tdbSNP:5030792
1690+c, tdbSNP:3397
1723+c, tdbSNP:114236595
1818+, gtttdbSNP:17883663
1845..1846+, gtttdbSNP:5746064
1862+a, cdbSNP:5746065
1900+c, tdbSNP:10157774
1928+a, gdbSNP:5746066
1947+c, tdbSNP:5746067
1953+c, gdbSNP:5746068
1996+c, tdbSNP:17880792
2029+a, gdbSNP:191982398
2049+a, gdbSNP:17881445
2104+c, tdbSNP:17880332
2135+c, tdbSNP:5746069
2136+g, tdbSNP:187438259
2248+c, tdbSNP:189604514
2297+a, gdbSNP:182211706
2312+c, tdbSNP:186856234
2313+c, gdbSNP:5746070
2339..2340+, gdbSNP:71568396
2365..2366+, adbSNP:71568397
2370..2371+, adbSNP:55651536
2397+c, tdbSNP:1061628
2421..2422+, tgaadbSNP:201523366
2425..2426+, tgaadbSNP:5746071
2425+, ttcadbSNP:78043422
2464+c, tdbSNP:139456075
2555+c, tdbSNP:6668561
2583+c, tdbSNP:77552668
2607+c, tdbSNP:61774891
2623+c, tdbSNP:113401157
2652+c, tdbSNP:5746072
2660+c, gdbSNP:183385861
2740+c, tdbSNP:11807940
2784+c, tdbSNP:117721591
2785+c, tdbSNP:17880872
2786+a, cdbSNP:17881461
2830+a, gdbSNP:148699600
2893+c, tdbSNP:13306717
2897+a, gdbSNP:1061631
2969+a, gdbSNP:1800621
2976+g, tdbSNP:17884182
2995+g, tdbSNP:113865581
3028+a, c, gdbSNP:1061642
3035+c, tdbSNP:5746073
3119+a, gdbSNP:5746074
3235+a, gdbSNP:5746075
3392+a, cdbSNP:191275160
3546+a, gdbSNP:183757270
3589..3590+, tgdbSNP:137939745
Gene SymbolTNFRSF1B
Gene SynonymCD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Chromosome1
Locus Map1p36.22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001066 Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA. In-stock $509.00 $460.00 12
Title Estradiol modulates tumor necrosis factor-induced endothelial inflammation: role of tumor necrosis factor receptor 2 .
Author Chakrabarti,S. and Davidge,S.T.
Journal J. Vasc. Res. 50 (1), 21-34 (2013)
Title Genetic polymorphisms of tumour necrosis factor receptor superfamily 1b and fas ligand are associated with clinical efficacy and/or acute severe infusion reactions to infliximab in Crohn's disease .
Author Steenholdt,C., Enevold,C., Ainsworth,M.A., Brynskov,J., Thomsen,O.O. and Bendtzen,K.
Journal Aliment. Pharmacol. Ther. 36 (7), 650-659 (2012)
Title Tumour necrosis factor alpha and oxidative stress as maintaining factors in the evolution of anorexia nervosa .
Author Agnello,E., Malfi,G., Costantino,A.M., Massarenti,P., Pugliese,M., Fortunati,N., Catalano,M.G. and Palmo,A.
Journal Eat Weight Disord 17 (3), E194-E199 (2012)
Title Both internalization and AIP1 association are required for tumor necrosis factor receptor 2-mediated JNK signaling .
Author Ji,W., Li,Y., Wan,T., Wang,J., Zhang,H., Chen,H. and Min,W.
Journal Arterioscler. Thromb. Vasc. Biol. 32 (9), 2271-2279 (2012)
Title Inflammation marker and risk of pancreatic cancer: a nested case-control study within the EPIC cohort .
Author Grote,V.A., Kaaks,R., Nieters,A., Tjonneland,A., Halkjaer,J., Overvad,K., Skjelbo Nielsen,M.R., Boutron-Ruault,M.C., Clavel-Chapelon,F., Racine,A., Teucher,B., Becker,S., Pischon,T., Boeing,H., Trichopoulou,A., Cassapa,C., Stratigakou,V., Palli,D., Krogh,V., Tumino,R., Vineis,P., Panico,S., Rodriguez,L., Duell,E.J., Sanchez,M.J., Dorronsoro,M., Navarro,C., Gurrea,A.B., Siersema,P.D., Peeters,P.H., Ye,W., Sund,M., Lindkvist,B., Johansen,D., Khaw,K.T., Wareham,N., Allen,N.E., Travis,R.C., Fedirko,V., Jenab,M., Michaud,D.S., Chuang,S.C., Romaguera,D., Bueno-de-Mesquita,H.B. and Rohrmann,S.
Journal Br. J. Cancer 106 (11), 1866-1874 (2012)
Title Down-modulation of cell surface expression of p80 form of the tumor necrosis factor receptor by human immunodeficiency virus-1 tat gene .
Author Pocsik,E., Higuchi,M. and Aggarwal,B.B.
Journal Lymphokine Cytokine Res. 11 (6), 317-325 (1992)
Title Biochemical properties of the 75-kDa tumor necrosis factor receptor. Characterization of ligand binding, internalization, and receptor phosphorylation .
Author Pennica,D., Lam,V.T., Mize,N.K., Weber,R.F., Lewis,M., Fendly,B.M., Lipari,M.T. and Goeddel,D.V.
Journal J. Biol. Chem. 267 (29), 21172-21178 (1992)
Title Tumour necrosis factor receptor distribution in human lymphoid tissue .
Author Ryffel,B., Brockhaus,M., Greiner,B., Mihatsch,M.J. and Gudat,F.
Journal Immunology 74 (3), 446-452 (1991)
Title The gene for the type II (p75) tumor necrosis factor receptor (TNF-RII) is localized on band 1p36.2-p36.3 .
Author Kemper,O., Derre,J., Cherif,D., Engelmann,H., Wallach,D. and Berger,R.
Journal Hum. Genet. 87 (5), 623-624 (1991)
Title [Gastroduodenal reflux and non-ulcerous dyspepsia. Is it an accidental association?] .
Author Bost,R. and Hostein,J.
Journal Ann Gastroenterol Hepatol (Paris) 27 (4), 191-192 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.