Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA.

Summary
Sequence
Translation
SNP
Other Variants
PubMed

RefSeq Version	NM_001066.2, 23312365
Length	3682 bp
Structure	linear
Update Date	24-APR-2011
Organism	Homo sapiens (human)
Definition	Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA.
Product	tumor necrosis factor receptor superfamily member 1B precursor
Comment	Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. [provided by RefSeq].

RefSeq	NP_001057.1
CDS	90..1475
Exon (1)	1..167
Exon (2)	1..167
Exon (3)	168..267
Exon (4)	268..396
Exon (5)	397..546
Exon (6)	547..640
Exon (7)	641..876
Exon (8)	877..954
Exon (9)	955..989
Exon (10)	990..1194
Exon (11)	1195..3675
Translation	MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.

Position	Chain	Variation	Link
15	+	g, t	dbSNP:5745949
31	+	c, t	dbSNP:5745950
61..62	+	, gcgagggc	dbSNP:5745951
120	+	a, g	dbSNP:113538181
complement(257)	-	t, c	dbSNP:945439
632	+	c, t	dbSNP:2275415
648	+	a, g	dbSNP:2228494
676	+	g, t	dbSNP:1061622
783	+	a, g	dbSNP:5746026
795	+	a, g	dbSNP:5746027
880	+	c, t	dbSNP:2229700
894	+	a, c	dbSNP:17879042
909	+	c, t	dbSNP:61761336
973	+	a, g	dbSNP:5746032
991	+	c, g	dbSNP:17883432
1042	+	a, c	dbSNP:116544657
1058	+	a, g	dbSNP:77990239
1146	+	a, g	dbSNP:112914333
1198	+	c, t	dbSNP:75299314
1213	+	a, g	dbSNP:55925819
1613	+	c, t	dbSNP:79862699
1663	+	a, g	dbSNP:1061624
1668	+	g, t	dbSNP:5030792
1690	+	c, t	dbSNP:3397
1723	+	c, t	dbSNP:114236595
1842	+	, gttt	dbSNP:17883663
1845..1846	+	, gttt	dbSNP:5746064
1862	+	a, c	dbSNP:5746065
1900	+	c, t	dbSNP:10157774
1928	+	a, g	dbSNP:5746066
1947	+	c, t	dbSNP:5746067
1953	+	c, g	dbSNP:5746068
1996	+	c, t	dbSNP:17880792
2049	+	a, g	dbSNP:17881445
2104	+	c, t	dbSNP:17880332
2135	+	c, t	dbSNP:5746069
2248	+	c, t	dbSNP:117453496
2313	+	c, g	dbSNP:5746070
2339..2340	+	, g	dbSNP:71568396
2369..2370	+	, a	dbSNP:71568397
2369	+	a, g	dbSNP:116230287
2379..2380	+	, a	dbSNP:55651536
2397	+	c, t	dbSNP:1061628
2425..2426	+	, tgaa	dbSNP:5746071
complement(2425)	-	, ttca	dbSNP:78043422
2555	+	c, t	dbSNP:6668561
2572	+	c, g	dbSNP:77739977
2583	+	c, t	dbSNP:77552668
2607	+	c, t	dbSNP:61774891
2623	+	c, t	dbSNP:113401157
2652	+	c, t	dbSNP:5746072
2740	+	c, t	dbSNP:11807940
2784	+	c, t	dbSNP:117721591
2785	+	c, t	dbSNP:17880872
2786	+	a, c	dbSNP:17881461
2893	+	c, t	dbSNP:13306717
2897	+	a, g	dbSNP:1061631
2969	+	a, g	dbSNP:1800621
2976	+	g, t	dbSNP:17884182
2995	+	g, t	dbSNP:113865581
3028	+	c, g	dbSNP:1061642
3035	+	c, t	dbSNP:5746073
3119	+	a, g	dbSNP:5746074
3235	+	a, g	dbSNP:5746075

Gene Symbol	TNFRSF1B
Gene Synonym	CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
Chromosome	1
Locus Map	1p36.22
All Transcripts	NM_001066

Title	TNFR2 interposes the proliferative and NF-kappaB-mediated inflammatory response by podocytes to TNF-alpha .
Author	Bruggeman,L.A., Drawz,P.E., Kahoud,N., Lin,K., Barisoni,L. and Nelson,P.J.
Journal	Lab. Invest. 91 (3), 413-425 (2011)
Title	TNFR2 - target for therapeutics against neurodegenerative diseases? .
Author	Nijholt,I.M., Granic,I., Luiten,P.G. and Eisel,U.L.
Journal	Adv. Exp. Med. Biol. 691, 567-573 (2011)
Title	Tumor necrosis factor-alpha signaling via TNFR1/p55 is deleterious whereas TNFR2/p75 signaling is protective in adult infarct myocardium .
Author	Kishore,R., Tkebuchava,T., Sasi,S.P., Silver,M., Gilbert,H.Y., Yoon,Y.S., Park,H.Y., Thorne,T., Losordo,D.W. and Goukassian,D.A.
Journal	Adv. Exp. Med. Biol. 691, 433-448 (2011)
Title	Elevated levels of soluble TNF receptors 1 and 2 correlate with Plasmodium falciparum parasitemia in pregnant women: potential markers for malaria-associated inflammation .
Author	Thevenon,A.D., Zhou,J.A., Megnekou,R., Ako,S., Leke,R.G. and Taylor,D.W.
Journal	J. Immunol. 185 (11), 7115-7122 (2010)
Title	The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia .
Author	Kim,D.H., Kong,J.H., Byeun,J.Y., Jung,C.W., Xu,W., Liu,X., Kamel-Reid,S., Kim,Y.K., Kim,H.J. and Lipton,J.H.
Journal	Clin. Cancer Res. 16 (21), 5339-5350 (2010)
Title	Down-modulation of cell surface expression of p80 form of the tumor necrosis factor receptor by human immunodeficiency virus-1 tat gene .
Author	Pocsik,E., Higuchi,M. and Aggarwal,B.B.
Journal	Lymphokine Cytokine Res. 11 (6), 317-325 (1992)
Title	Biochemical properties of the 75-kDa tumor necrosis factor receptor. Characterization of ligand binding, internalization, and receptor phosphorylation .
Author	Pennica,D., Lam,V.T., Mize,N.K., Weber,R.F., Lewis,M., Fendly,B.M., Lipari,M.T. and Goeddel,D.V.
Journal	J. Biol. Chem. 267 (29), 21172-21178 (1992)
Title	Tumour necrosis factor receptor distribution in human lymphoid tissue .
Author	Ryffel,B., Brockhaus,M., Greiner,B., Mihatsch,M.J. and Gudat,F.
Journal	Immunology 74 (3), 446-452 (1991)
Title	The gene for the type II (p75) tumor necrosis factor receptor (TNF-RII) is localized on band 1p36.2-p36.3 .
Author	Kemper,O., Derre,J., Cherif,D., Engelmann,H., Wallach,D. and Berger,R.
Journal	Hum. Genet. 87 (5), 623-624 (1991)
Title	[Gastroduodenal reflux and non-ulcerous dyspepsia. Is it an accidental association?] .
Author	Bost,R. and Hostein,J.
Journal	Ann Gastroenterol Hepatol (Paris) 27 (4), 191-192 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

	Secured Online Quotation
	Email: gene@genscript.com
	Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
	Fax: 1-732-210-0262 1-732-885-5878

RefSeq Accession	Definition	Sequence	Price	Select
NM_001066	Homo sapiens tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), mRNA.	Full Lenth	$1288.70
NM_001066		ORF Sequence	$401.94