• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens jade family PHD finger 3 (JADE3), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu06648 Homo sapiens jade family PHD finger 3 (JADE3), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu06648C Homo sapiens jade family PHD finger 3 (JADE3), transcript variant 2, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001077445.2, 531990848
Length 2472 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens jade family PHD finger 3 (JADE3), transcript variant 2, mRNA.
Product protein Jade-3
Comment

Summary: This gene encodes a member of a family of large proteins containing PHD (plant homeo domain)-type zinc fingers. The encoded protein may be associated in a nuclear complex that functions in histone H4 acetylation. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2013].


Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1 and 2 encode the same protein.


##Evidence-Data-START## Transcript exon combination :: AK291220.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025092, ERS025094 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_001070913.1
CDS 77..2548
Misc Feature(1)164..166
Misc Feature(2)164..166
Misc Feature(3)170..172
Misc Feature(4)188..610
Misc Feature(5)188..190
Misc Feature(6)329..331
Misc Feature(7)680..820
Misc Feature(8)833..1171
Misc Feature(9)1718..1720
Misc Feature(10)1721..1723
Misc Feature(11)1772..1774
Misc Feature(12)1772..1774
Misc Feature(13)1988..1990
Misc Feature(14)2396..2398
Misc Feature(15)2402..2404
Misc Feature(16)2414..2416
Exon (1)1..65
Gene:JADE3
Gene Synonym:JADE-3; PHF16
Exon (2)66..122
Gene:JADE3
Gene Synonym:JADE-3; PHF16
Exon (3)123..202
Gene:JADE3
Gene Synonym:JADE-3; PHF16
Exon (4)203..360
Gene:JADE3
Gene Synonym:JADE-3; PHF16
Exon (5)361..551
Gene:JADE3
Gene Synonym:JADE-3; PHF16
Exon (6)552..763
Gene:JADE3
Gene Synonym:JADE-3; PHF16
Exon (7)764..931
Gene:JADE3
Gene Synonym:JADE-3; PHF16
Exon (8)932..1048
Gene:JADE3
Gene Synonym:JADE-3; PHF16
Exon (9)1049..1519
Gene:JADE3
Gene Synonym:JADE-3; PHF16
Exon (10)1520..1637
Gene:JADE3
Gene Synonym:JADE-3; PHF16
Exon (11)1638..4713
Gene:JADE3
Gene Synonym:JADE-3; PHF16
Translation MKRHRPVSSSDSSDESPSTSFTSGSMYRIKSKIPNEHKKPAEVFRKDLISAMKLPDSHHI NPDSYYLFADTWKEEWEKGVQVPASPDTVPQPSLRIIAEKVKDVLFIRPRKYIHCSSPDT TEPGYINIMELAASVCRYDLDDMDIFWLQELNEDLAEMGCGPVDENLMEKTVEVLERHCH ENMNHAIETEEGLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNVCVHQACYGILKVPEG SWLCRSCVLGIYPQCVLCPKKGGALKTTKTGTKWAHVSCALWIPEVSIACPERMEPITKI SHIPPSRWALVCNLCKLKTGACIQCSIKSCITAFHVTCAFEHGLEMKTILDEGDEVKFKS YCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFYSLVRVEDVAAEL GMPTLAVDFIYNYWKLKRKSNFNKPLFPPKEDEENGLVQPKEESIHTRMRMFMHLRQDLE RVRNLCYMISRREKLKLSHNKIQEQIFGLQVQLLNQEIDAGLPLTNALENSLFYPPPRIT LKLKMPKSTPEDHRNSSTETDQQPHSPDSSSSVHSIRNMQVPQESLEMRTKSYPRYPLES KNNRLLASLSHSRSEAKESSPAWRTPSSECYHGQSLGKPLVLQAALHGQSSIGNGKSQPN SKFAKSNGLEGSWSGNVTQKDSSSEMFCDQEPVFSPHLVSQGSFRKSTVEHFSRSFKETT NRWVKNTEDLQCYVKPTKNMSPKEQFWGRQVLRRSAGRAPYQENDGYCPDLELSDSEAES DGNKEKVRVRKDSSDRENPPHDSRRDCHGKSKTHPLSHSSMQR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
170+dbSNP:
170+a, gdbSNP:192950306
371+dbSNP:
371+a, gdbSNP:144788692
373+a, gdbSNP:147931279
401+a, cdbSNP:202130393
405+a, gdbSNP:372578744
436+c, tdbSNP:140188063
450+a, tdbSNP:377097099
474+c, tdbSNP:200132654
503+a, gdbSNP:145705934
577+dbSNP:
577+a, tdbSNP:369548861
783+dbSNP:
783+a, gdbSNP:148832173
977..978+dbSNP:
977..978+, cdbSNP:34521244
995+a, cdbSNP:372660068
1033+g, tdbSNP:200395115
1036+a, gdbSNP:376908669
1100+dbSNP:
1100+c, tdbSNP:201053091
1200+c, tdbSNP:58593047
1299+a, gdbSNP:143458465
1328+a, gdbSNP:150948956
1348+a, gdbSNP:140782937
1366+c, tdbSNP:144726372
1467+a, gdbSNP:138719055
1485+g, tdbSNP:374456033
1496+a, cdbSNP:200186609
1555+dbSNP:
1555+a, gdbSNP:141837491
1597+c, tdbSNP:145597232
1609+a, cdbSNP:185744814
1622+c, gdbSNP:200690550
1684+dbSNP:
1684+a, gdbSNP:191000371
1688+a, gdbSNP:370737469
1721+a, gdbSNP:184045617
1735+c, tdbSNP:138131718
1775+c, gdbSNP:374074570
1796+c, tdbSNP:149554867
1801+c, tdbSNP:144241933
1802+a, gdbSNP:148731538
1829+c, tdbSNP:143159816
1832+c, tdbSNP:267606459
1886+c, tdbSNP:373596462
1894+a, gdbSNP:199519658
1898+a, cdbSNP:147507918
1927+a, gdbSNP:368009548
1928+c, gdbSNP:140120440
1975+a, gdbSNP:145641249
1985+a, gdbSNP:370622472
2079+a, gdbSNP:201740623
2155+a, gdbSNP:151109669
2234+a, gdbSNP:373703041
2246+a, gdbSNP:367575533
2296+a, gdbSNP:372926726
2312+c, tdbSNP:35292182
2336+c, tdbSNP:149868129
2441+g, tdbSNP:376113165
2451+a, tdbSNP:368354377
2457+c, tdbSNP:144893581
2469+a, gdbSNP:140898718
2519+c, gdbSNP:143309546
2527+c, tdbSNP:372342525
2590+a, gdbSNP:200908034
2671+a, gdbSNP:193047907
2712+a, gdbSNP:183088891
2724+c, tdbSNP:146863913
2791+a, gdbSNP:376777669
2807+a, gdbSNP:140556609
2828+c, tdbSNP:187385515
2835+a, gdbSNP:374021517
2983..2984+, cdbSNP:201855646
2984..2985+, adbSNP:77032153
2987..2988+, adbSNP:66617346
2987+a, cdbSNP:200251754
2988+c, tdbSNP:201551649
2989+g, tdbSNP:202104218
3022+a, gdbSNP:72616714
3049..3050+, adbSNP:397687141
3070+c, tdbSNP:191789323
3194+c, gdbSNP:375597755
3720+g, tdbSNP:370779792
3729+, adbSNP:398122052
3798+c, tdbSNP:55679253
3817+c, tdbSNP:150447188
4043+c, gdbSNP:184156684
4176+c, gdbSNP:5905581
4183+, adbSNP:200946864
4289+g, tdbSNP:189328411
4466+a, gdbSNP:192662197
4496+a, gdbSNP:185659565
4665+a, gdbSNP:190712523
4671+a, cdbSNP:6725
4711+c, gdbSNP:181766192
Gene SymbolJADE3
Gene SynonymJADE-3; PHF16
ChromosomeX
Locus MapXp11.23
Title Whole-exome sequencing identifies mutated PCK2 and HUWE1 associated with carcinoma cell proliferation in a hepatocellular carcinoma patient .
Author Liu YX, Zhang SF, Ji YH, Guo SJ, Wang GF and Zhang GW.
Journal Oncol Lett 4 (4), 847-851 (2012)
Title ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation .
Author Doyon Y, Cayrou C, Ullah M, Landry AJ, Cote V, Selleck W, Lane WS, Tan S, Yang XJ and Cote J.
Journal Mol. Cell 21 (1), 51-64 (2006)
Title Identification of Jade1, a gene encoding a PHD zinc finger protein, in a gene trap mutagenesis screen for genes involved in anteroposterior axis development .
Author Tzouanacou E, Tweedie S and Wilson V.
Journal Mol. Cell. Biol. 23 (23), 8553-8552 (2003)
Title An integrated, functionally annotated gene map of the DXS8026-ELK1 interval on human Xp11.3-Xp11.23: potential hotspot for neurogenetic disorders .
Author Thiselton DL, McDowall J, Brandau O, Ramser J, d'Esposito F, Bhattacharya SS, Ross MT, Hardcastle AJ and Meindl A.
Journal Genomics 79 (4), 560-572 (2002)
Title Identification of human estrogen-inducible transcripts that potentially mediate the apoptotic response in breast cancer .
Author Szelei J, Soto AM, Geck P, Desronvil M, Prechtl NV, Weill BC and Sonnenschein C.
Journal J. Steroid Biochem. Mol. Biol. 72 (3-4), 89-102 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.