Sequence in raw or FASTA format:
Homo sapiens PHD finger protein 16 (PHF16), transcript variant 2, mRNA.
| RefSeq Version | NM_001077445.1, 117190333 |
| Length | 4685 bp |
| Structure | linear |
| Update Date | 24-DEC-2010 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens PHD finger protein 16 (PHF16), transcript variant 2, mRNA. |
| Product | protein Jade-3 |
| Comment | Summary: This gene is part of a gene cluster on chromosome Xp11.23. The encoded protein contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq]. Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1 and 2 encode the same protein. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. COMPLETENESS: complete on the 3' end. |
| RefSeq | NP_001070913.1 |
| CDS | 52..2523 | Exon (1) | 1..40 | Exon (2) | 1..40 | Exon (3) | 41..97 | Exon (4) | 98..177 | Exon (5) | 178..335 | Exon (6) | 336..526 | Exon (7) | 527..738 | Exon (8) | 739..906 | Exon (9) | 907..1023 | Exon (10) | 1024..1494 | Exon (11) | 1495..1612 | Exon (12) | 1613..4685 |
| Translation | MKRHRPVSSSDSSDESPSTSFTSGSMYRIKSKIPNEHKKPAEVFRKDLISAMKLPDSHHI
NPDSYYLFADTWKEEWEKGVQVPASPDTVPQPSLRIIAEKVKDVLFIRPRKYIHCSSPDT
TEPGYINIMELAASVCRYDLDDMDIFWLQELNEDLAEMGCGPVDENLMEKTVEVLERHCH
ENMNHAIETEEGLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNVCVHQACYGILKVPEG
SWLCRSCVLGIYPQCVLCPKKGGALKTTKTGTKWAHVSCALWIPEVSIACPERMEPITKI
SHIPPSRWALVCNLCKLKTGACIQCSIKSCITAFHVTCAFEHGLEMKTILDEGDEVKFKS
YCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFYSLVRVEDVAAEL
GMPTLAVDFIYNYWKLKRKSNFNKPLFPPKEDEENGLVQPKEESIHTRMRMFMHLRQDLE
RVRNLCYMISRREKLKLSHNKIQEQIFGLQVQLLNQEIDAGLPLTNALENSLFYPPPRIT
LKLKMPKSTPEDHRNSSTETDQQPHSPDSSSSVHSIRNMQVPQESLEMRTKSYPRYPLES
KNNRLLASLSHSRSEAKESSPAWRTPSSECYHGQSLGKPLVLQAALHGQSSIGNGKSQPN
SKFAKSNGLEGSWSGNVTQKDSSSEMFCDQEPVFSPHLVSQGSFRKSTVEHFSRSFKETT
NRWVKNTEDLQCYVKPTKNMSPKEQFWGRQVLRRSAGRAPYQENDGYCPDLELSDSEAES
DGNKEKVRVRKDSSDRENPPHDSRRDCHGKSKTHPLSHSSMQR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 952..953 | + | , c | dbSNP:34521244 |
| 1175 | + | c, t | dbSNP:58593047 |
| 2287 | + | c, t | dbSNP:35292182 |
| 2959..2960 | + | , a | dbSNP:77032153 |
| 2960..2961 | + | , a | dbSNP:60028922 |
| 2961..2962 | + | , a | dbSNP:66617346 |
| 2994..2995 | + | , a | dbSNP:57088583 |
| 2995..2996 | + | , a | dbSNP:66751307 |
| 2995 | + | a, g | dbSNP:72616714 |
| 3001..3002 | + | , a | dbSNP:58169421 |
| 3002..3003 | + | , a | dbSNP:67495828 |
| 3019..3020 | + | , a | dbSNP:67753663 |
| 3020..3021 | + | , a | dbSNP:59370972 |
| 3021..3022 | + | , a | dbSNP:66534110 |
| 3683..3684 | + | , g | dbSNP:71980267 |
| 3696 | + | , a | dbSNP:67647922 |
| 3701 | + | , a | dbSNP:60606687 |
| 3770 | + | c, t | dbSNP:55679253 |
| 4148 | + | c, g | dbSNP:5905581 |
| 4643 | + | a, c | dbSNP:6725 |
| Gene Symbol | PHF16 |
| Gene Synonym | JADE3; KIAA0215; MGC138748; MGC138749 |
| Chromosome | X |
| Locus Map | Xp11.23 |
| All Transcripts | NM_001077445 , NM_014735 |
| Title | Global, in vivo, and site-specific phosphorylation dynamics in signaling networks . |
| Author | Olsen,J.V., Blagoev,B., Gnad,F., Macek,B., Kumar,C., Mortensen,P. and Mann,M. |
| Journal | Cell 127 (3), 635-648 (2006) |
| Title | ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation . |
| Author | Doyon,Y., Cayrou,C., Ullah,M., Landry,A.J., Cote,V., Selleck,W., Lane,W.S., Tan,S., Yang,X.J. and Cote,J. |
| Journal | Mol. Cell 21 (1), 51-64 (2006) |
| Title | The DNA sequence of the human X chromosome . |
| Author | Ross,M.T., Grafham,D.V., Coffey,A.J., Scherer,S., McLay,K., Muzny,D., Platzer,M., Howell,G.R., Burrows,C., Bird,C.P., Frankish,A., Lovell,F.L., Howe,K.L., Ashurst,J.L., Fulton,R.S., Sudbrak,R., Wen,G., Jones,M.C., Hurles,M.E., Andrews,T.D., Scott,C.E., Searle,S., Ramser,J., Whittaker,A., Deadman,R., Carter,N.P., Hunt,S.E., Chen,R., Cree,A., Gunaratne,P., Havlak,P., Hodgson,A., Metzker,M.L., Richards,S., Scott,G., Steffen,D., Sodergren,E., Wheeler,D.A., Worley,K.C., Ainscough,R., Ambrose,K.D., Ansari-Lari,M.A., Aradhya,S., Ashwell,R.I., Babbage,A.K., Bagguley,C.L., Ballabio,A., Banerjee,R., Barker,G.E., Barlow,K.F., Barrett,I.P., Bates,K.N., Beare,D.M., Beasley,H., Beasley,O., Beck,A., Bethel,G., Blechschmidt,K., Brady,N., Bray-Allen,S., Bridgeman,A.M., Brown,A.J., Brown,M.J., Bonnin,D., Bruford,E.A., Buhay,C., Burch,P., Burford,D., Burgess,J., Burrill,W., Burton,J., Bye,J.M., Carder,C., Carrel,L., Chako,J., Chapman,J.C., Chavez,D., Chen,E., Chen,G., Chen,Y., Chen,Z., Chinault,C., Ciccodicola,A., Clark,S.Y., Clarke,G., Clee,C.M., Clegg,S., Clerc-Blankenburg,K., Clifford,K., Cobley,V., Cole,C.G., Conquer,J.S., Corby,N., Connor,R.E., David,R., Davies,J., Davis,C., Davis,J., Delgado,O., Deshazo,D., Dhami,P., Ding,Y., Dinh,H., Dodsworth,S., Draper,H., Dugan-Rocha,S., Dunham,A., Dunn,M., Durbin,K.J., Dutta,I., Eades,T., Ellwood,M., Emery-Cohen,A., Errington,H., Evans,K.L., Faulkner,L., Francis,F., Frankland,J., Fraser,A.E., Galgoczy,P., Gilbert,J., Gill,R., Glockner,G., Gregory,S.G., Gribble,S., Griffiths,C., Grocock,R., Gu,Y., Gwilliam,R., Hamilton,C., Hart,E.A., Hawes,A., Heath,P.D., Heitmann,K., Hennig,S., Hernandez,J., Hinzmann,B., Ho,S., Hoffs,M., Howden,P.J., Huckle,E.J., Hume,J., Hunt,P.J., Hunt,A.R., Isherwood,J., Jacob,L., Johnson,D., Jones,S., de Jong,P.J., Joseph,S.S., Keenan,S., Kelly,S., Kershaw,J.K., Khan,Z., Kioschis,P., Klages,S., Knights,A.J., Kosiura,A., Kovar-Smith,C., Laird,G.K., Langford,C., Lawlor,S., Leversha,M., Lewis,L., Liu,W., Lloyd,C., Lloyd,D.M., Loulseged,H., Loveland,J.E., Lovell,J.D., Lozado,R., Lu,J., Lyne,R., Ma,J., Maheshwari,M., Matthews,L.H., McDowall,J., McLaren,S., McMurray,A., Meidl,P., Meitinger,T., Milne,S., Miner,G., Mistry,S.L., Morgan,M., Morris,S., Muller,I., Mullikin,J.C., Nguyen,N., Nordsiek,G., Nyakatura,G., O'Dell,C.N., Okwuonu,G., Palmer,S., Pandian,R., Parker,D., Parrish,J., Pasternak,S., Patel,D., Pearce,A.V., Pearson,D.M., Pelan,S.E., Perez,L., Porter,K.M., Ramsey,Y., Reichwald,K., Rhodes,S., Ridler,K.A., Schlessinger,D., Schueler,M.G., Sehra,H.K., Shaw-Smith,C., Shen,H., Sheridan,E.M., Shownkeen,R., Skuce,C.D., Smith,M.L., Sotheran,E.C., Steingruber,H.E., Steward,C.A., Storey,R., Swann,R.M., Swarbreck,D., Tabor,P.E., Taudien,S., Taylor,T., Teague,B., Thomas,K., Thorpe,A., Timms,K., Tracey,A., Trevanion,S., Tromans,A.C., d'Urso,M., Verduzco,D., Villasana,D., Waldron,L., Wall,M., Wang,Q., Warren,J., Warry,G.L., Wei,X., West,A., Whitehead,S.L., Whiteley,M.N., Wilkinson,J.E., Willey,D.L., Williams,G., Williams,L., Williamson,A., Williamson,H., Wilming,L., Woodmansey,R.L., Wray,P.W., Yen,J., Zhang,J., Zhou,J., Zoghbi,H., Zorilla,S., Buck,D., Reinhardt,R., Poustka,A., Rosenthal,A., Lehrach,H., Meindl,A., Minx,P.J., Hillier,L.W., Willard,H.F., Wilson,R.K., Waterston,R.H., Rice,C.M., Vaudin,M., Coulson,A., Nelson,D.L., Weinstock,G., Sulston,J.E., Durbin,R., Hubbard,T., Gibbs,R.A., Beck,S., Rogers,J. and Bentley,D.R. |
| Journal | Nature 434 (7031), 325-337 (2005) |
| Title | Large-scale characterization of HeLa cell nuclear phosphoproteins . |
| Author | Beausoleil,S.A., Jedrychowski,M., Schwartz,D., Elias,J.E., Villen,J., Li,J., Cohn,M.A., Cantley,L.C. and Gygi,S.P. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135 (2004) |
| Title | Identification of Jade1, a gene encoding a PHD zinc finger protein, in a gene trap mutagenesis screen for genes involved in anteroposterior axis development . |
| Author | Tzouanacou,E., Tweedie,S. and Wilson,V. |
| Journal | Mol. Cell. Biol. 23 (23), 8553-8552 (2003) |
| Title | An integrated, functionally annotated gene map of the DXS8026-ELK1 interval on human Xp11.3-Xp11.23: potential hotspot for neurogenetic disorders . |
| Author | Thiselton,D.L., McDowall,J., Brandau,O., Ramser,J., d'Esposito,F., Bhattacharya,S.S., Ross,M.T., Hardcastle,A.J. and Meindl,A. |
| Journal | Genomics 79 (4), 560-572 (2002) |
| Title | Identification of human estrogen-inducible transcripts that potentially mediate the apoptotic response in breast cancer . |
| Author | Szelei,J., Soto,A.M., Geck,P., Desronvil,M., Prechtl,N.V., Weill,B.C. and Sonnenschein,C. |
| Journal | J. Steroid Biochem. Mol. Biol. 72 (3-4), 89-102 (2000) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |