Search Tips

  • THAT   AND
  • THAT   AND


Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001077480 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA. Full Lenth $405.71
ORF Sequence $307.11


RefSeq Version NM_001077480.2, 319039299
Length 1399 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA.
Product nuclear receptor subfamily 1 group I member 3 isoform 2
Comment

Summary: This gene encodes a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members. Unlike most nuclear receptors, this transcriptional regulator is constitutively active in the absence of ligand but is regulated by both agonists and inverse agonists. Ligand binding results in translocation of this protein to the nucleus, where it activates or represses target gene transcription. These ligands include bilirubin, a variety of foreign compounds, steroid hormones, and prescription drugs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq].


Transcript Variant: This variant (2) uses an alternate splice site in the 3' coding region, compared to variant 1. The resulting protein (isoform 2) is shorter than isoform 1.
RefSeq NP_001070948.1
CDS 204..1262
Exon (1)1..170
Exon (2)1..170
Exon (3)171..310
Exon (4)311..441
Exon (5)442..611
Exon (6)612..751
Exon (7)752..897
Exon (8)898..1026
Exon (9)1027..1132
Exon (10)1133..1393
Translation MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQR RHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGA HTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLP VFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQV EFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYI KGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolNR1I3
Gene SynonymCAR; CAR1; MB67; MGC150433; MGC97144; MGC97209
Chromosome1
Locus Map1q23.3
All Transcripts NM_001077480 , NM_001077481 , NM_001077482 , NM_001077478 , NM_001077469 , NM_005122 , NM_001077471 , NM_001077472 , NM_001077473 , NM_001077474 , NM_001077475 , NM_001077476 , NM_001077477 , NM_001077479 , NM_001077470
Title CCAAT/enhancer-binding protein alpha (C/EBPalpha) and hepatocyte nuclear factor 4alpha (HNF4alpha) synergistically cooperate with constitutive androstane receptor to transactivate the human cytochrome P450 2B6 (CYP2B6) gene: application to the development of a metabolically competent human hepatic cell model .
Author Benet,M., Lahoz,A., Guzman,C., Castell,J.V. and Jover,R.
Journal J. Biol. Chem. 285 (37), 28457-28471 (2010)
Title Genetic polymorphisms of CYP1A2, CYP3A4, CYP3A5, pregnane/steroid X receptor and constitutive androstane receptor in 207 healthy Spanish volunteers .
Author Oliver,P., Lubomirov,R. and Carcas,A.
Journal Clin. Chem. Lab. Med. 48 (5), 635-639 (2010)
Title Effect of oncostatin M on uridine diphosphate-5'-glucuronosyltransferase 1A1 through cross talk with constitutive androstane receptor .
Author Masuyama,H., Nakatsukasa,H. and Hiramatsu,Y.
Journal Mol. Endocrinol. 24 (4), 745-753 (2010)
Title Dephosphorylation of threonine 38 is required for nuclear translocation and activation of human xenobiotic receptor CAR (NR1I3) .
Author Mutoh,S., Osabe,M., Inoue,K., Moore,R., Pedersen,L., Perera,L., Rebolloso,Y., Sueyoshi,T. and Negishi,M.
Journal J. Biol. Chem. 284 (50), 34785-34792 (2009)
Title Association of a single nucleotide polymorphism in the constitutive androstane receptor gene with bone mineral density .
Author Urano,T., Usui,T., Shiraki,M., Ouchi,Y. and Inoue,S.
Journal Geriatr Gerontol Int 9 (3), 235-241 (2009)
Title Inhibition of estrogen receptor action by the orphan receptor SHP (short heterodimer partner) .
Author Seol,W., Hanstein,B., Brown,M. and Moore,D.D.
Journal Mol. Endocrinol. 12 (10), 1551-1557 (1998)
Title Differential transactivation by two isoforms of the orphan nuclear hormone receptor CAR .
Author Choi,H.S., Chung,M., Tzameli,I., Simha,D., Lee,Y.K., Seol,W. and Moore,D.D.
Journal J. Biol. Chem. 272 (38), 23565-23571 (1997)
Title An orphan nuclear hormone receptor that lacks a DNA binding domain and heterodimerizes with other receptors .
Author Seol,W., Choi,H.S. and Moore,D.D.
Journal Science 272 (5266), 1336-1339 (1996)
Title A component of the 26S proteasome binds on orphan member of the nuclear hormone receptor superfamily .
Author Choi,H.S., Seol,W. and Moore,D.D.
Journal J. Steroid Biochem. Mol. Biol. 56 (1-6 SPEC NO), 23-30 (1996)
Title A new orphan member of the nuclear hormone receptor superfamily that interacts with a subset of retinoic acid response elements .
Author Baes,M., Gulick,T., Choi,H.S., Martinoli,M.G., Simha,D. and Moore,D.D.
Journal Mol. Cell. Biol. 14 (3), 1544-1552 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878