• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001077480 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_001077480.2, 319039299
Length 1399 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA.
Product nuclear receptor subfamily 1 group I member 3 isoform 2
Comment

Summary: This gene encodes a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members. Unlike most nuclear receptors, this transcriptional regulator is constitutively active in the absence of ligand but is regulated by both agonists and inverse agonists. Ligand binding results in translocation of this protein to the nucleus, where it activates or represses target gene transcription. These ligands include bilirubin, a variety of foreign compounds, steroid hormones, and prescription drugs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) uses an alternate splice site in the 3' coding region, compared to variant 1. The resulting protein (isoform 2) is shorter than isoform 1.

RefSeq NP_001070948.1
CDS 204..1262
Misc Feature(1)52
Misc Feature(2)159..161
Misc Feature(3)234..449
Misc Feature(4)234..449
Misc Feature(5)order(234..236,243..245,285..287,294..296,342..344,
Misc Feature(6)order(264..272,288..293,297..299,309..314,381..386,
Misc Feature(7)315..317
Misc Feature(8)order(345..350,387..389,438..443)
Misc Feature(9)519..1253
Misc Feature(10)order(681..686,693..698,705..707,810..812,819..821,
Misc Feature(11)order(720..722,732..734,750..752,771..776,783..788,
Misc Feature(12)order(936..938,1026..1028,1059..1061,1068..1070,
Exon (1)1..170
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (2)171..310
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (3)311..441
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (4)442..611
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (5)612..751
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (6)752..897
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (7)898..1026
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (8)1027..1132
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (9)1133..1393
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Translation MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQR RHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGA HTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLP VFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQV EFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYI KGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(159)-g, adbSNP:181499203
complement(161)-t, cdbSNP:188975149
complement(201)-dbSNP:
complement(201)-g, adbSNP:2307415
complement(246)-t, cdbSNP:200774078
complement(278)-t, cdbSNP:140012276
complement(348)-dbSNP:
complement(348)-g, adbSNP:201089859
complement(382)-t, cdbSNP:142842008
complement(383)-c, adbSNP:138077816
complement(385)-t, cdbSNP:148277311
complement(416)-t, gdbSNP:200078573
complement(421)-t, cdbSNP:112022118
complement(452)-dbSNP:
complement(452)-g, adbSNP:2307425
complement(461)-g, cdbSNP:35205211
complement(491)-t, cdbSNP:141229326
complement(492)-t, cdbSNP:34161743
complement(505)-t, gdbSNP:142448385
complement(554)-g, adbSNP:146059027
complement(555)-g, cdbSNP:139629845
complement(571)-t, cdbSNP:139473535
complement(600)-t, cdbSNP:149303773
complement(629)-dbSNP:
complement(629)-g, adbSNP:150598676
complement(647)-t, cdbSNP:138159825
complement(658)-g, adbSNP:202054823
complement(706)-g, adbSNP:41270857
complement(743)-t, cdbSNP:2307424
complement(744)-t, cdbSNP:143067018
complement(893)-g, adbSNP:149864108
complement(895)-t, cdbSNP:145025028
complement(927)-dbSNP:
complement(927)-g, adbSNP:146624074
complement(952)-t, cdbSNP:201406656
complement(963)-g, adbSNP:144211465
complement(1008)-t, cdbSNP:113800307
complement(1023)-c, adbSNP:1140627
complement(1025)-t, adbSNP:66915105
complement(1028)-dbSNP:
complement(1028)-g, adbSNP:201028035
complement(1030)-t, cdbSNP:142330499
complement(1109)-t, gdbSNP:199534928
complement(1117)-t, cdbSNP:200523878
complement(1125)-g, adbSNP:148675838
complement(1131)-g, adbSNP:143583938
complement(1132)-t, cdbSNP:114879683
complement(1144)-g, adbSNP:200408085
complement(1145)-g, adbSNP:36017137
complement(1154)-t, gdbSNP:150124500
complement(1155)-g, c, adbSNP:2307414
complement(1183)-t, adbSNP:139722132
complement(1193)-g, adbSNP:79799851
complement(1238)-t, cdbSNP:200228217
complement(1241)-c, adbSNP:141332323
complement(1247)-t, cdbSNP:141389397
complement(1264)-t, cdbSNP:140549301
complement(1270)-g, adbSNP:147849659
complement(1331)-t, cdbSNP:3813629
complement(1346)-g, adbSNP:201243903
complement(1347)-g, adbSNP:34645321
complement(1348)-g, adbSNP:2307416
Gene SymbolNR1I3
Gene SynonymCAR; CAR1; MB67
Chromosome1
Locus Map1q23.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001077469 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 6, mRNA. On-demand $549.00 14
NM_001077470 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 11, mRNA. On-demand $449.00 14
NM_001077471 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 5, mRNA. On-demand $449.00 14
NM_001077472 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 9, mRNA. On-demand $549.00 14
NM_001077473 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 12, mRNA. On-demand $449.00 14
NM_001077474 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 8, mRNA. On-demand $449.00 14
NM_001077475 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 15, mRNA. On-demand $449.00 14
NM_001077476 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 13, mRNA. On-demand $449.00 14
NM_001077477 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 14, mRNA. On-demand $449.00 14
NM_001077478 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 7, mRNA. On-demand $549.00 14
NM_001077479 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 10, mRNA. On-demand $549.00 14
NM_001077480 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA. On-demand $549.00 14
NM_001077481 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 4, mRNA. On-demand $449.00 14
NM_001077482 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 1, mRNA. On-demand $549.00 14
NM_005122 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 3, mRNA. In-stock $418.00 $369.00 10
Title The orphan nuclear receptor DAX-1 functions as a potent corepressor of the constitutive androstane receptor (NR1I3) .
Author Laurenzana,E.M., Chen,T., Kannuswamy,M., Sell,B.E., Strom,S.C., Li,Y. and Omiecinski,C.J.
Journal Mol. Pharmacol. 82 (5), 918-928 (2012)
Title DP97, a DEAD box DNA/RNA helicase, is a target gene-selective co-regulator of the constitutive androstane receptor .
Author Kanno,Y., Serikawa,T., Inajima,J. and Inouye,Y.
Journal Biochem. Biophys. Res. Commun. 426 (1), 38-42 (2012)
Title Transactivation of ABCG2 through a novel cis-element in the distal promoter by constitutive androstane receptor but not pregnane X receptor in human hepatocytes .
Author Benoki,S., Yoshinari,K., Chikada,T., Imai,J. and Yamazoe,Y.
Journal Arch. Biochem. Biophys. 517 (2), 123-130 (2012)
Title MicroRNA-122 down-regulation is involved in phenobarbital-mediated activation of the constitutive androstane receptor .
Author Shizu,R., Shindo,S., Yoshida,T. and Numazawa,S.
Journal PLoS ONE 7 (7), E41291 (2012)
Title Active ERK1/2 protein interacts with the phosphorylated nuclear constitutive active/androstane receptor (CAR; NR1I3), repressing dephosphorylation and sequestering CAR in the cytoplasm .
Author Osabe,M. and Negishi,M.
Journal J. Biol. Chem. 286 (41), 35763-35769 (2011)
Title Inhibition of estrogen receptor action by the orphan receptor SHP (short heterodimer partner) .
Author Seol,W., Hanstein,B., Brown,M. and Moore,D.D.
Journal Mol. Endocrinol. 12 (10), 1551-1557 (1998)
Title Differential transactivation by two isoforms of the orphan nuclear hormone receptor CAR .
Author Choi,H.S., Chung,M., Tzameli,I., Simha,D., Lee,Y.K., Seol,W. and Moore,D.D.
Journal J. Biol. Chem. 272 (38), 23565-23571 (1997)
Title An orphan nuclear hormone receptor that lacks a DNA binding domain and heterodimerizes with other receptors .
Author Seol,W., Choi,H.S. and Moore,D.D.
Journal Science 272 (5266), 1336-1339 (1996)
Title A component of the 26S proteasome binds on orphan member of the nuclear hormone receptor superfamily .
Author Choi,H.S., Seol,W. and Moore,D.D.
Journal J. Steroid Biochem. Mol. Biol. 56 (1-6 SPEC NO), 23-30 (1996)
Title A new orphan member of the nuclear hormone receptor superfamily that interacts with a subset of retinoic acid response elements .
Author Baes,M., Gulick,T., Choi,H.S., Martinoli,M.G., Simha,D. and Moore,D.D.
Journal Mol. Cell. Biol. 14 (3), 1544-1552 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.