• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu34915 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu34915C Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001077480.2, 319039299
Length 1059 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA.
Product nuclear receptor subfamily 1 group I member 3 isoform 2
Comment

Summary: This gene encodes a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members. Unlike most nuclear receptors, this transcriptional regulator is constitutively active in the absence of ligand but is regulated by both agonists and inverse agonists. Ligand binding results in translocation of this protein to the nucleus, where it activates or represses target gene transcription. These ligands include bilirubin, a variety of foreign compounds, steroid hormones, and prescription drugs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) uses an alternate splice site in the 3' coding region, compared to variant 1. The resulting protein (isoform 2) is shorter than isoform 1.

RefSeq NP_001070948.1
CDS 204..1262
Misc Feature(1)52
Misc Feature(2)159..161
Misc Feature(3)234..449
Misc Feature(4)234..449
Misc Feature(5)order(234..236,243..245,285..287,294..296,342..344,
Misc Feature(6)order(264..272,288..293,297..299,309..314,381..386,
Misc Feature(7)315..317
Misc Feature(8)order(345..350,387..389,438..443)
Misc Feature(9)519..1253
Misc Feature(10)order(681..686,693..698,705..707,810..812,819..821,
Misc Feature(11)order(720..722,732..734,750..752,771..776,783..788,
Misc Feature(12)order(936..938,1026..1028,1059..1061,1068..1070,
Exon (1)1..170
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (2)171..310
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (3)311..441
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (4)442..611
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (5)612..751
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (6)752..897
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (7)898..1026
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (8)1027..1132
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Exon (9)1133..1393
Gene:NR1I3
Gene Synonym:CAR; CAR1; MB67
Translation MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQR RHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGA HTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLP VFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQV EFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYI KGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(148)-t, cdbSNP:376555075
complement(152)-t, adbSNP:372090555
complement(159)-g, adbSNP:181499203
complement(161)-t, cdbSNP:188975149
complement(189)-dbSNP:
complement(189)-g, cdbSNP:376099705
complement(201)-t, cdbSNP:386564613
complement(201)-g, adbSNP:2307415
complement(206)-t, cdbSNP:373168365
complement(246)-t, cdbSNP:200774078
complement(278)-t, cdbSNP:140012276
complement(348)-dbSNP:
complement(348)-g, adbSNP:201089859
complement(382)-t, cdbSNP:142842008
complement(383)-c, adbSNP:138077816
complement(385)-t, cdbSNP:148277311
complement(416)-t, gdbSNP:200078573
complement(421)-t, cdbSNP:112022118
complement(451)-dbSNP:
complement(451)-g, adbSNP:373897043
complement(452)-g, adbSNP:2307425
complement(452)-g, adbSNP:386564614
461+c, gdbSNP:35205211
complement(472)-t, cdbSNP:376162036
complement(491)-t, cdbSNP:141229326
492+c, tdbSNP:34161743
complement(493)-t, cdbSNP:368339212
complement(496)-t, cdbSNP:375295397
complement(546)-g, adbSNP:376834028
complement(554)-g, adbSNP:146059027
complement(555)-g, cdbSNP:139629845
complement(557)-t, cdbSNP:370461642
complement(559)-t, cdbSNP:377243932
complement(568)-g, cdbSNP:372603248
complement(571)-t, cdbSNP:139473535
complement(600)-t, cdbSNP:149303773
complement(629)-dbSNP:
complement(629)-g, adbSNP:150598676
complement(643)-g, cdbSNP:369446796
complement(647)-t, cdbSNP:138159825
complement(658)-g, adbSNP:202054823
complement(687)-t, cdbSNP:375116822
complement(692)-g, adbSNP:367668454
complement(706)-g, adbSNP:41270857
743+c, tdbSNP:2307424
complement(744)-t, cdbSNP:143067018
complement(893)-g, adbSNP:149864108
complement(895)-t, cdbSNP:145025028
complement(927)-dbSNP:
complement(927)-g, adbSNP:146624074
943+c, tdbSNP:398122411
complement(952)-t, cdbSNP:201406656
complement(963)-g, adbSNP:144211465
complement(1008)-t, cdbSNP:113800307
1023+a, cdbSNP:1140627
1025+a, tdbSNP:66915105
complement(1028)-dbSNP:
complement(1028)-g, adbSNP:201028035
complement(1030)-t, cdbSNP:142330499
complement(1109)-t, gdbSNP:199534928
complement(1117)-t, cdbSNP:200523878
complement(1125)-g, adbSNP:148675838
complement(1131)-g, adbSNP:143583938
complement(1132)-t, cdbSNP:114879683
complement(1144)-g, adbSNP:200408085
1145+a, gdbSNP:36017137
complement(1151)-t, cdbSNP:373127924
complement(1154)-t, gdbSNP:150124500
1155+a, c, g, tdbSNP:2307414
complement(1173)-g, adbSNP:369817002
complement(1174)-t, cdbSNP:376397342
complement(1183)-t, adbSNP:139722132
complement(1193)-g, adbSNP:79799851
complement(1209)-g, adbSNP:373882046
complement(1238)-t, cdbSNP:200228217
complement(1241)-c, adbSNP:141332323
complement(1247)-t, cdbSNP:141389397
complement(1253)-t, gdbSNP:369311646
complement(1264)-t, cdbSNP:140549301
complement(1269)-c, adbSNP:376510791
complement(1270)-g, adbSNP:147849659
complement(1331)-t, cdbSNP:3813629
complement(1346)-g, adbSNP:201243903
1347+a, gdbSNP:34645321
1348+a, gdbSNP:2307416
complement(1385)-t, cdbSNP:368521829
Gene SymbolNR1I3
Gene SynonymCAR; CAR1; MB67
Chromosome1
Locus Map1q23.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005122 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 3, mRNA. In-stock $99.00 5-7
NM_001077471 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 5, mRNA. On-demand $159.00 7-9
NM_001077476 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 13, mRNA. On-demand $159.00 7-9
NM_001077472 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 9, mRNA. On-demand $159.00 7-9
NM_001077475 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 15, mRNA. On-demand $159.00 7-9
NM_001077473 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 12, mRNA. On-demand $159.00 7-9
NM_001077477 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 14, mRNA. On-demand $159.00 7-9
NM_001077470 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 11, mRNA. On-demand $159.00 7-9
NM_001077478 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 7, mRNA. On-demand $219.00 7-9
NM_001077474 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 8, mRNA. On-demand $159.00 7-9
NM_001077469 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 6, mRNA. On-demand $219.00 7-9
NM_001077479 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 10, mRNA. On-demand $159.00 7-9
NM_001077480 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_001077481 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 4, mRNA. On-demand $159.00 7-9
NM_001077482 Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant 1, mRNA. On-demand $219.00 7-9
XM_005245693 PREDICTED: Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant X1, mRNA. On-demand $219.00 7-9
XM_005245694 PREDICTED: Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant X2, mRNA. On-demand $219.00 7-9
XM_005245697 PREDICTED: Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant X5, mRNA. On-demand $219.00 7-9
XM_006711696 PREDICTED: Homo sapiens nuclear receptor subfamily 1, group I, member 3 (NR1I3), transcript variant X6, mRNA. On-demand $159.00 7-9
Title The time point of beta-catenin knockout in hepatocytes determines their response to xenobiotic activation of the constitutive androstane receptor .
Author Ganzenberg K, Singh Y and Braeuning A.
Journal Toxicology 308, 113-121 (2013)
Title p38 Mitogen-activated protein kinase regulates nuclear receptor CAR that activates the CYP2B6 gene .
Author Saito K, Moore R and Negishi M.
Journal Drug Metab. Dispos. 41 (6), 1170-1173 (2013)
Title Expression of nuclear receptors (AhR, PXR, CAR) and transcription factor (Nrf2) in human parotid gland .
Author Drozdzik A, Kowalczyk R, Urasinska E and Kurzawski M.
Journal Acta Pol Pharm 70 (2), 215-219 (2013)
Title Polymorphisms in regulators of xenobiotic transport and metabolism genes PXR and CAR do not affect multiple myeloma risk: a case-control study in the context of the IMMEnSE consortium .
Author Martino A, Sainz J, Manuel Reis R, Moreno V, Buda G, Lesueur F, Marques H, Garcia-Sanz R, Rios R, Stein A, Dumontet C, Gemignani F, Maria Rossi A, Landi S, Jurado M, Petrini M, Jamroziak K, Campa D and Canzian F.
Journal J. Hum. Genet. 58 (3), 155-159 (2013)
Title Gadd45 in the liver: signal transduction and transcriptional mechanisms .
Author Tian J and Locker J.
Journal Adv. Exp. Med. Biol. 793, 69-80 (2013)
Title Inhibition of estrogen receptor action by the orphan receptor SHP (short heterodimer partner) .
Author Seol W, Hanstein B, Brown M and Moore DD.
Journal Mol. Endocrinol. 12 (10), 1551-1557 (1998)
Title Differential transactivation by two isoforms of the orphan nuclear hormone receptor CAR .
Author Choi HS, Chung M, Tzameli I, Simha D, Lee YK, Seol W and Moore DD.
Journal J. Biol. Chem. 272 (38), 23565-23571 (1997)
Title An orphan nuclear hormone receptor that lacks a DNA binding domain and heterodimerizes with other receptors .
Author Seol W, Choi HS and Moore DD.
Journal Science 272 (5266), 1336-1339 (1996)
Title A component of the 26S proteasome binds on orphan member of the nuclear hormone receptor superfamily .
Author Choi HS, Seol W and Moore DD.
Journal J. Steroid Biochem. Mol. Biol. 56 (1-6 SPEC NO), 23-30 (1996)
Title A new orphan member of the nuclear hormone receptor superfamily that interacts with a subset of retinoic acid response elements .
Author Baes M, Gulick T, Choi HS, Martinoli MG, Simha D and Moore DD.
Journal Mol. Cell. Biol. 14 (3), 1544-1552 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.