• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cubilin (intrinsic factor-cobalamin receptor) (CUBN), mRNA.


RefSeq Accession Definition Services Price Order
NM_001081 Homo sapiens cubilin (intrinsic factor-cobalamin receptor) (CUBN), mRNA. ORF Sequence Quote
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001081.3, 126091151
Length 11933 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cubilin (intrinsic factor-cobalamin receptor) (CUBN), mRNA.
Product cubilin precursor
Comment

Summary: Cubilin (CUBN) acts as a receptor for intrinsic factor-vitamin B12 complexes. The role of receptor is supported by the presence of 27 CUB domains. Cubulin is located within the epithelium of intestine and kidney. Mutations in CUBN may play a role in autosomal recessive megaloblastic anemia. [provided by RefSeq, Jul 2008].

RefSeq NP_001072.2
CDS 53..10924
Misc Feature(1)155..160
Misc Feature(2)461..553
Misc Feature(3)560..682
Misc Feature(4)order(560..562,569..571,626..628)
Misc Feature(5)839..946
Misc Feature(6)order(839..841,848..850,896..898)
Misc Feature(7)965..1081
Misc Feature(8)order(965..967,974..976,1028..1030)
Misc Feature(9)1109..>1186
Misc Feature(10)1241..1342
Misc Feature(11)order(1244..1246,1283..1285)
Misc Feature(12)1346..1456
Misc Feature(13)order(1346..1348,1355..1357,1397..1399)
Misc Feature(14)1472..1807
Misc Feature(15)order(1496..1498,1502..1504,1508..1510,1589..1591,
Misc Feature(16)1820..2149
Misc Feature(17)order(1844..1846,1850..1852,1856..1858,1937..1939,
Misc Feature(18)2174..2497
Misc Feature(19)order(2198..2200,2204..2206,2210..2212,2291..2293,
Misc Feature(20)2501..2833
Misc Feature(21)order(2522..2524,2528..2530,2534..2536,2615..2617,
Misc Feature(22)2846..3175
Misc Feature(23)order(2876..2878,2882..2884,2963..2965,2978..2980,
Misc Feature(24)3221..3526
Misc Feature(25)order(3224..3226,3230..3232,3311..3313,3326..3328,
Misc Feature(26)3545..3877
Misc Feature(27)order(3569..3571,3575..3577,3581..3583,3662..3664,
Misc Feature(28)3896..4216
Misc Feature(29)order(3914..3916,3920..3922,3926..3928,4007..4009,
Misc Feature(30)4223..4567
Misc Feature(31)order(4253..4255,4259..4261,4340..4342,4355..4357,
Misc Feature(32)4580..4903
Misc Feature(33)order(4604..4606,4610..4612,4616..4618,4697..4699,
Misc Feature(34)4910..5251
Misc Feature(35)order(4937..4939,4943..4945,4949..4951,5033..5035,
Misc Feature(36)5264..5593
Misc Feature(37)order(5288..5290,5294..5296,5300..5302,5381..5383,
Misc Feature(38)5606..5938
Misc Feature(39)order(5630..5632,5636..5638,5642..5644,5723..5725,
Misc Feature(40)5984..6316
Misc Feature(41)order(6014..6016,6020..6022,6026..6028,6104..6106,
Misc Feature(42)6326..6688
Misc Feature(43)order(6356..6358,6362..6364,6443..6445,6458..6460,
Misc Feature(44)6701..7051
Misc Feature(45)order(6737..6739,6743..6745,6749..6751,6830..6832,
Misc Feature(46)7058..7393
Misc Feature(47)order(7082..7084,7088..7090,7094..7096,7178..7180,
Misc Feature(48)7406..7744
Misc Feature(49)order(7436..7438,7442..7444,7523..7525,7538..7540,
Misc Feature(50)7760..8110
Misc Feature(51)order(7787..7789,7793..7795,7799..7801,7892..7894,
Misc Feature(52)8117..8452
Misc Feature(53)order(8141..8143,8147..8149,8153..8155,8234..8236,
Misc Feature(54)8465..8806
Misc Feature(55)order(8489..8491,8495..8497,8501..8503,8582..8584,
Misc Feature(56)8810..9154
Misc Feature(57)order(8834..8836,8840..8842,8846..8848,8927..8929,
Misc Feature(58)9161..9496
Misc Feature(59)order(9185..9187,9191..9193,9197..9199,9281..9283,
Misc Feature(60)9521..9871
Misc Feature(61)order(9548..9550,9551..9553,9557..9559,9644..9646,
Misc Feature(62)9884..10228
Misc Feature(63)order(9914..9916,9920..9922,9926..9928,10007..10009,
Misc Feature(64)10235..10570
Misc Feature(65)order(10259..10261,10265..10267,10271..10273,10352..10354,
Misc Feature(66)10583..10915
Misc Feature(67)order(10613..10615,10619..10621,10700..10702,10715..10717,
Misc Feature(68)563..691
Misc Feature(69)563..691
Misc Feature(70)1103..1247
Misc Feature(71)1248..1348
Misc Feature(72)1349..1462
Misc Feature(73)1472..1819
Misc Feature(74)1472..1819
Misc Feature(75)1820..2173
Misc Feature(76)1820..2173
Misc Feature(77)2174..2500
Misc Feature(78)2174..2500
Misc Feature(79)2501..2845
Misc Feature(80)2501..2845
Misc Feature(81)2846..3193
Misc Feature(82)2846..3193
Misc Feature(83)3194..3544
Misc Feature(84)4223..4579
Misc Feature(85)4910..5263
Misc Feature(86)4910..5263
Misc Feature(87)5984..6325
Misc Feature(88)5984..6325
Misc Feature(89)6701..7057
Misc Feature(90)6701..7057
Misc Feature(91)7058..7405
Misc Feature(92)7058..7405
Misc Feature(93)7406..7759
Misc Feature(94)7406..7759
Misc Feature(95)7760..8116
Misc Feature(96)7760..8116
Misc Feature(97)8465..8809
Misc Feature(98)8810..9160
Misc Feature(99)8810..9160
Misc Feature(100)9161..9520
Misc Feature(101)9161..9520
Misc Feature(102)9521..9883
Misc Feature(103)9521..9883
Misc Feature(104)10235..10582
Misc Feature(105)10235..10582
Misc Feature(106)10583..10921
Exon (1)1..174
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (2)175..304
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (3)305..400
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (4)401..439
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (5)440..541
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (6)542..645
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (7)646..772
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (8)773..935
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (9)936..1067
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (10)1068..1163
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (11)1164..1282
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (12)1283..1469
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (13)1470..1582
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (14)1583..1817
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (15)1818..1999
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (16)2000..2162
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (17)2163..2353
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (18)2354..2498
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (19)2499..2677
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (20)2678..2843
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (21)2844..3060
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (22)3061..3191
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (23)3192..3381
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (24)3382..3542
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (25)3543..3724
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (26)3725..3881
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (27)3882..4069
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (28)4070..4220
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (29)4221..4402
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (30)4403..4577
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (31)4578..4747
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (32)4748..4907
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (33)4908..5021
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (34)5022..5132
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (35)5133..5261
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (36)5262..5394
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (37)5395..5600
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (38)5601..5785
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (39)5786..5978
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (40)5979..6176
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (41)6177..6323
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (42)6324..6514
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (43)6515..6698
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (44)6699..6873
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (45)6874..7052
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (46)7053..7262
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (47)7263..7403
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (48)7404..7585
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (49)7586..7757
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (50)7758..7964
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (51)7965..8114
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (52)8115..8236
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (53)8237..8462
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (54)8463..8650
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (55)8651..8807
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (56)8808..8957
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (57)8958..9158
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (58)9159..9288
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (59)9289..9506
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (60)9507..9715
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (61)9716..9878
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (62)9879..10084
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (63)10085..10232
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (64)10233..10414
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (65)10415..10580
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (66)10581..10816
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Exon (67)10817..11933
Gene:CUBN
Gene Synonym:gp280; IFCR; MGA1
Translation MMNMSLPFLWSLLTLLIFAEVNGEAGELELQRQKRSINLQQPRMATERGNLVFLTGSAQN IEFRTGSLGKIKLNDEDLSECLHQIQKNKEDIIELKGSAIGLPQNISSQIYQLNSKLVDL ERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGT PLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDDCEGGSVARCVHGICEDLMREQAGE PKYSCVCDAGWMFSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGWQGNG YICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVSNGGC HPDASCSSTLGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSHPCLNGQCIDTVSGYFCKC DSGWTGVNCTENINECLSNPCLNGGTCVDGVDSFSCECTRLWTGALCQVPQQVCGESLSG INGSFSYRSPDVGYVHDVNCFWVIKTEMGKVLRITFTFFRLESMDNCPHEFLQVYDGDSS SAFQLGRFCGSSLPHELLSSDNALYFHLYSEHLRNGRGFTVRWETQQPECGGILTGPYGS IKSPGYPGNYPPGRDCVWIVVTSPDLLVTFTFGTLSLEHHDDCNKDYLEIRDGPLYQDPL LGKFCTTFSVPPLQTTGPFARIHFHSDSQISDQGFHITYLTSPSDLRCGGNYTDPEGELF LPELSGPFTHTRQCVYMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCG NGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGDELTGEGVIRSPFFPNVYPGER TCRWTIHQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSFIT SVYNFLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPNVYPHGINCTW HILVQPNHLIHLMFETFHLEFHYNCTNDYLEVYDTDSETSLGRYCGKSIPPSLTSSGNSL MLVFVTDSDLAYEGFLINYEAISAATACLQDYTDDLGTFTSPNFPNNYPNNWECIYRITV RTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPTIISHSNKLW LKFKSDQIDTRSGFSAYWDGSSTGCGGNLTTSSGTFISPNYPMPYYHSSECYWWLKSSHG SAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQLCGDEKPPLIRSSGDSMFIKLR TDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYPNPYSENQHCNWTIRATTGNTVNY TFLAFDLEHHINCSTDYLELYDGPRQMGRYCGVDLPPPGSTTSSKLQVLLLTDGVGRREK GFQMQWFVYGCGGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVEY HSRCNFDVLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFN ASWQAVTGGCGGIFQAPSGEIHSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEPQ DSCIMAYDGLSSTMSRLARTCGREQLANPIVSSGNSLFLRFQSGPSRQNRGFRAQFRQAC GGHILTSSFDTVSSPRFPANYPNNQNCSWIIQAQPPLNHITLSFTHFELERSTTCARDFV EILDGGHEDAPLRGRYCGTDMPHPITSFSSALTLRFVSDSSISAGGFHTTVTASVSACGG TFYMAEGIFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQDCSRDFVEIRE GNATGHLVGRYCGNSFPLNYSSIVGHTLWVRFISDGSGSGTGFQATFMKIFGNDNIVGTH GKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDIEEIQNCYYDKLRIYDGPSIHA RLIGAYCGTQTESFSSTGNSLTFHFYSDSSISGKGFLLEWFAVDAPDGVLPTIAPGACGG FLRTGDAPVFLFSPGWPDSYSNRVDCTWLIQAPDSTVELNILSLDIESHRTCAYDSLVIR DGDNNLAQQLAVLCGREIPGPIRSTGEYMFIRFTSDSSVTRAGFNASFHKSCGGYLHADR GIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPD ICSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGN VYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL ELRDGVDSDAPILSKFCGTSLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGGRV PGQSGVVESIGHPTLPYRDNLFCEWHLQGLSGHYLTISFEDFNLQNSSGCEKDFVEIWDN HTSGNILGRYCGNTIPDSIDTSSNTAVVRFVTDGSVTASGFRLRFESSMEECGGDLQGSI GTFTSPNYPNPNPHGRICEWRITAPEGRRITLMFNNLRLATHPSCNNEHVIVFNGIRSNS PQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGSLPNTPEG NFTSPGYDGVRNYSRNLNCEWTLSNPNQGNSSISIHFEDFYLESHQDCQFDVLEFRVGDA DGPLMWRLCGPSKPTLPLVIPYSQVWIHFVTNERVEHIGFHAKYSFTDCGGIQIGDSGVI TSPNYPNAYDSLTHCSSLLEAPQGHTITLTFSDFDIEPHTTCAWDSVTVRNGGSPESPII GQYCGNSNPRTIQSGSNQLVVTFNSDHSLQGGGFYATWNTQTLGCGGIFHSDNGTIRSPH WPQNFPENSRCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKALLA TGCGNVAPGPVITPSNTFTAVFQSQEAPAQGFSASFVSRCGSNFTGPSGYIISPNYPKQY DNNMNCTYVIEANPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYSVMSTPFATVCG DEMPAPLTIAGPVLLNFYSNEQITDFGFKFSYRIISCGGVFNFSSGIITSPAYSYADYPN DMHCLYTITVSDDKVIELKFSDFDVVPSTSCSHDYLAIYDGANTSDPLLGKFCGSKRPPN VKSSNNSMLLVFKTDSFQTAKGWKMSFRQTLGPQQGCGGYLTGSNNTFASPDSDSNGMYD KNLNCVWIIIAPVNKVIHLTFNTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFCGST VPAPFISSGNFLTVQFISDLTLEREGFNATYTIMDMPCGGTYNATWTPQNISSPNSSDPD VPFSICTWVIDSPPHQQVKITVWALQLTSQDCTQNYLQLQDSPQGHGNSRFQFCGRNASA VPVFYSSMSTAMVIFKSGVVNRNSRMSFTYQIADCNRDYHKAFGNLRSPGWPDNYDNDKD CTVTLTAPQNHTISLFFHSLGIENSVECRNDFLEVRNGSNSNSPLLGKYCGTLLPNPVFS QNNELYLRFKSDSVTSDRGYEIIWTSSPSGCGGTLYGDRGSFTSPGYPGTYPNNTYCEWV LVAPAGRLVTINFYFISIDDPGDCVQNYLTLYDGPNASSPSSGPYCGGDTSIAPFVASSN QVFIKFHADYARRPSAFRLTWDS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(55)-c, adbSNP:11254385
complement(56)-t, cdbSNP:200499216
complement(122)-t, cdbSNP:148596785
complement(161)-t, gdbSNP:76788243
complement(180)-dbSNP:
complement(180)-t, cdbSNP:149358798
complement(227)-g, cdbSNP:139326193
complement(228)-t, cdbSNP:189082398
complement(248)-t, cdbSNP:12259370
complement(257..258)-, cdbSNP:35215782
complement(282)-t, cdbSNP:200173898
complement(307)-dbSNP:
complement(307)-t, gdbSNP:202136129
complement(347)-t, cdbSNP:143919998
complement(351)-g, adbSNP:138350638
complement(422)-dbSNP:
complement(422)-t, adbSNP:1801220
complement(443)-dbSNP:
complement(443)-t, cdbSNP:142159836
complement(461)-t, gdbSNP:202053511
complement(479)-t, gdbSNP:151018922
complement(504)-t, gdbSNP:143590644
complement(528)-g, adbSNP:201361280
complement(625)-t, gdbSNP:1801221
complement(670)-dbSNP:
complement(670)-g, adbSNP:41289313
complement(671)-t, cdbSNP:199977353
complement(709)-t, cdbSNP:142553474
complement(722)-t, gdbSNP:143120669
complement(723)-t, cdbSNP:139891639
complement(810)-dbSNP:
complement(810)-t, cdbSNP:1801222
complement(843)-g, cdbSNP:144440300
complement(865)-g, adbSNP:139348777
complement(866)-t, cdbSNP:146035059
complement(931)-t, cdbSNP:142466038
complement(962)-dbSNP:
complement(962)-t, cdbSNP:78201384
complement(991)-t, cdbSNP:1801223
complement(1013)-g, adbSNP:143829410
complement(1015)-g, adbSNP:150309054
complement(1055)-t, cdbSNP:57335729
complement(1062)-g, adbSNP:202153130
complement(1074)-dbSNP:
complement(1074)-t, cdbSNP:149517557
complement(1121)-t, adbSNP:200802531
complement(1140)-t, cdbSNP:138044409
complement(1182)-dbSNP:
complement(1182)-g, adbSNP:112462530
complement(1217)-g, c, adbSNP:1801224
complement(1242)-t, cdbSNP:140397272
complement(1263)-g, cdbSNP:148260250
complement(1282)-g, adbSNP:144627803
complement(1288)-dbSNP:
complement(1288)-g, adbSNP:201404467
complement(1297)-g, adbSNP:12571671
complement(1401)-t, cdbSNP:146463364
complement(1507)-g, adbSNP:144057253
complement(1514)-t, adbSNP:191835973
complement(1522)-t, cdbSNP:143255616
complement(1558)-t, cdbSNP:145818316
complement(1564)-g, cdbSNP:2228053
complement(1575)-g, adbSNP:140039617
complement(1590)-dbSNP:
complement(1590)-t, cdbSNP:147322950
complement(1611)-c, adbSNP:145380076
complement(1621)-g, cdbSNP:202118604
complement(1639)-g, adbSNP:201018997
complement(1656)-t, cdbSNP:139848689
complement(1733)-t, cdbSNP:147449194
complement(1737)-t, cdbSNP:141475297
complement(1771)-t, adbSNP:148313915
complement(1779..1780)-, cdbSNP:34033621
complement(1801..1802)-, cdbSNP:35886112
complement(1823)-t, cdbSNP:144548751
complement(1846)-g, adbSNP:140184467
complement(1863)-g, adbSNP:200537125
complement(1934)-t, cdbSNP:201421596
complement(1963)-g, adbSNP:41289311
complement(1978)-g, adbSNP:201938886
complement(1999)-c, adbSNP:193027863
complement(2003)-dbSNP:
complement(2003)-g, cdbSNP:182512508
complement(2026)-t, gdbSNP:144862515
complement(2051)-t, cdbSNP:141089159
complement(2065)-t, cdbSNP:137892259
complement(2068)-t, cdbSNP:148107237
complement(2133)-g, cdbSNP:140201182
complement(2155)-t, cdbSNP:143693723
complement(2184)-t, cdbSNP:142424994
complement(2190)-g, adbSNP:141420691
complement(2191)-t, cdbSNP:112672544
complement(2234)-g, adbSNP:147752521
complement(2240)-g, adbSNP:7905349
complement(2308)-t, gdbSNP:140150973
complement(2309)-t, cdbSNP:77886913
complement(2313)-t, gdbSNP:147878491
complement(2370)-dbSNP:
complement(2370)-g, cdbSNP:200658389
complement(2395)-g, adbSNP:149758972
complement(2420)-t, cdbSNP:139824256
complement(2497)-g, adbSNP:116350428
complement(2504)-t, cdbSNP:141274853
complement(2528)-t, cdbSNP:141874896
complement(2535)-t, cdbSNP:199527884
complement(2539)-g, adbSNP:1801225
complement(2544)-c, adbSNP:200839400
complement(2610)-g, adbSNP:199728931
complement(2623)-g, adbSNP:17432826
complement(2646)-t, cdbSNP:138083522
complement(2662)-t, cdbSNP:143471343
complement(2677)-c, adbSNP:149242963
complement(2688)-dbSNP:
complement(2688)-t, cdbSNP:142606277
complement(2708)-t, cdbSNP:138545198
complement(2726)-t, cdbSNP:150108298
complement(2729)-t, cdbSNP:188342700
complement(2790)-t, cdbSNP:201589187
complement(2806)-g, adbSNP:113344959
complement(2808)-t, cdbSNP:148869805
complement(2862)-g, adbSNP:200383906
complement(2908)-g, adbSNP:147722747
complement(2914)-g, adbSNP:147077130
complement(2918)-t, cdbSNP:141859334
complement(2938)-t, cdbSNP:146730713
complement(2946)-t, cdbSNP:147955566
complement(2957)-g, cdbSNP:11254354
complement(2974)-g, adbSNP:201802902
complement(2975)-t, cdbSNP:199835213
complement(2981)-g, adbSNP:142292210
complement(3003)-t, adbSNP:200851536
complement(3013)-g, adbSNP:148712017
complement(3079)-dbSNP:
complement(3079)-g, adbSNP:145169791
complement(3121)-t, cdbSNP:201375347
complement(3145)-t, cdbSNP:1801226
complement(3146)-t, cdbSNP:1801227
complement(3168)-t, cdbSNP:150014503
complement(3192)-dbSNP:
complement(3192)-t, gdbSNP:139578779
complement(3227)-c, adbSNP:149167341
complement(3263)-t, cdbSNP:200252556
complement(3274)-g, adbSNP:146001133
complement(3282)-t, cdbSNP:184585798
complement(3304)-t, cdbSNP:142560894
complement(3322)-g, adbSNP:139454937
complement(3344)-c, adbSNP:146593010
complement(3408)-dbSNP:
complement(3408)-g, adbSNP:141164907
complement(3443)-t, cdbSNP:201138390
complement(3444)-t, gdbSNP:148199286
complement(3469)-g, adbSNP:1801228
complement(3478)-t, adbSNP:200107383
complement(3547)-dbSNP:
complement(3547)-g, adbSNP:143531829
complement(3548)-t, cdbSNP:201443885
complement(3574)-g, adbSNP:1873469
complement(3597)-g, adbSNP:199636722
complement(3655)-g, adbSNP:112675306
complement(3656)-t, c, adbSNP:141740096
complement(3698)-g, cdbSNP:145881708
complement(3722)-c, adbSNP:45588636
complement(3744)-dbSNP:
complement(3744)-t, cdbSNP:150277370
complement(3778)-g, adbSNP:141080797
complement(3798)-t, cdbSNP:151039810
complement(3804)-g, cdbSNP:115048360
complement(3875)-t, gdbSNP:189294363
complement(3908)-dbSNP:
complement(3908)-g, cdbSNP:140636441
complement(3942)-t, cdbSNP:121434430
complement(3959)-t, gdbSNP:200203056
complement(3961)-g, adbSNP:144116294
complement(3964)-t, cdbSNP:139281325
complement(3994)-t, cdbSNP:144532564
complement(4040)-g, adbSNP:149749419
complement(4144)-dbSNP:
complement(4144)-g, cdbSNP:199763912
complement(4182)-t, cdbSNP:139600855
complement(4219)-g, adbSNP:150510291
complement(4222)-dbSNP:
complement(4222)-g, adbSNP:199794945
complement(4252)-g, adbSNP:150663813
complement(4275)-g, cdbSNP:201428284
complement(4294)-t, gdbSNP:138052938
complement(4302)-c, adbSNP:199743759
complement(4353)-t, cdbSNP:147373223
complement(4358)-g, adbSNP:142737296
complement(4398)-c, adbSNP:148355121
complement(4428)-dbSNP:
complement(4428)-g, cdbSNP:138022214
complement(4449)-c, adbSNP:149220088
complement(4472)-g, adbSNP:201251467
complement(4509)-c, adbSNP:138327709
complement(4511)-g, adbSNP:145661597
complement(4554)-g, adbSNP:201587209
complement(4587)-dbSNP:
complement(4587)-t, cdbSNP:201939489
complement(4615)-t, adbSNP:1801229
complement(4673)-g, adbSNP:146824506
complement(4712)-t, cdbSNP:143716845
complement(4721)-g, adbSNP:140970422
complement(4723)-c, adbSNP:151197305
complement(4727)-t, cdbSNP:1801231
complement(4753)-dbSNP:
complement(4753)-g, adbSNP:113941731
complement(4773)-g, adbSNP:144132364
complement(4779)-t, cdbSNP:201923548
complement(4792)-t, cdbSNP:200115233
complement(4805)-g, adbSNP:145061533
complement(4823)-t, cdbSNP:201056237
complement(4847)-g, adbSNP:139479742
complement(4849)-c, adbSNP:201294291
complement(4890)-c, adbSNP:147343635
complement(4924)-g, adbSNP:114958584
complement(4925)-g, adbSNP:201801709
complement(5029)-dbSNP:
complement(5029)-c, adbSNP:79666480
complement(5057)-t, gdbSNP:112671925
complement(5059)-g, adbSNP:138417786
complement(5063)-t, gdbSNP:144472791
complement(5101)-g, cdbSNP:141941868
complement(5121)-g, adbSNP:141640975
complement(5125)-g, cdbSNP:200977290
complement(5136)-dbSNP:
complement(5136)-t, cdbSNP:145880377
complement(5144)-t, cdbSNP:201661017
complement(5150)-t, cdbSNP:116114483
complement(5153)-t, cdbSNP:201380512
complement(5186)-g, adbSNP:2271468
complement(5241)-g, adbSNP:201958183
complement(5248)-g, adbSNP:182162293
complement(5259)-g, adbSNP:191787640
complement(5274)-dbSNP:
complement(5274)-g, adbSNP:144943516
complement(5337)-c, adbSNP:149164899
complement(5356)-g, adbSNP:61841454
complement(5357)-t, cdbSNP:74116778
complement(5375)-t, cdbSNP:1276708
complement(5396)-dbSNP:
complement(5396)-t, adbSNP:140820026
complement(5401)-g, cdbSNP:147607921
complement(5407)-t, cdbSNP:199509575
complement(5414)-g, adbSNP:145305920
complement(5447)-g, adbSNP:139724058
complement(5449)-g, adbSNP:147772422
complement(5463)-g, adbSNP:142061158
complement(5464)-t, cdbSNP:199695111
complement(5468)-t, gdbSNP:146438022
complement(5476)-c, adbSNP:148649437
complement(5480)-g, adbSNP:143944436
complement(5481)-t, cdbSNP:149622438
complement(5511)-t, cdbSNP:139369652
complement(5552)-t, adbSNP:146351739
complement(5570)-t, cdbSNP:2271462
complement(5574)-g, adbSNP:138989259
complement(5600)-t, adbSNP:200277745
complement(5642)-dbSNP:
complement(5642)-t, cdbSNP:199693560
complement(5678)-c, adbSNP:145026134
complement(5707)-t, cdbSNP:1801233
complement(5717)-t, cdbSNP:141834956
complement(5732)-t, cdbSNP:76789390
complement(5768)-g, adbSNP:186721969
complement(5809)-dbSNP:
complement(5809)-g, cdbSNP:79184887
complement(5814)-t, cdbSNP:192022688
complement(5835)-c, adbSNP:201513648
complement(5839)-g, adbSNP:143697792
complement(5855)-t, cdbSNP:41289305
complement(5858)-t, adbSNP:200784089
complement(5859)-t, gdbSNP:201543114
complement(5892)-t, gdbSNP:147617753
complement(5893)-g, cdbSNP:199868206
complement(5908)-g, adbSNP:1801234
complement(5909)-g, cdbSNP:141489700
complement(5910)-t, cdbSNP:185959848
complement(5912)-t, cdbSNP:147848629
complement(5914)-t, cdbSNP:181991723
complement(5942)-t, cdbSNP:201074959
complement(5944)-c, adbSNP:200395852
complement(5963)-t, gdbSNP:2356590
complement(5976)-g, adbSNP:41289303
complement(6003)-g, adbSNP:150924438
complement(6014)-g, adbSNP:142570571
complement(6019)-g, cdbSNP:139153235
complement(6053)-t, cdbSNP:146364943
complement(6061)-t, cdbSNP:142138187
complement(6072)-g, adbSNP:140202552
complement(6073)-t, cdbSNP:144381598
complement(6079)-g, adbSNP:200331505
complement(6091)-g, adbSNP:149569558
complement(6101)-c, adbSNP:76555786
complement(6141)-t, cdbSNP:143400113
complement(6143)-t, cdbSNP:150392211
complement(6145)-t, cdbSNP:141470763
complement(6147)-t, cdbSNP:201720797
complement(6185)-dbSNP:
complement(6185)-t, gdbSNP:188111808
complement(6194)-g, cdbSNP:146995189
complement(6197)-g, cdbSNP:141319759
complement(6240)-t, cdbSNP:138959174
complement(6258)-g, adbSNP:143197663
complement(6266)-g, adbSNP:149102355
complement(6277)-t, cdbSNP:75737363
complement(6315)-g, adbSNP:74844886
complement(6320)-t, cdbSNP:201374966
complement(6328)-dbSNP:
complement(6328)-g, adbSNP:146319349
complement(6393)-t, gdbSNP:146692241
complement(6396)-t, cdbSNP:143835350
complement(6416)-t, cdbSNP:140117869
complement(6446)-t, cdbSNP:150659522
complement(6511)-g, cdbSNP:62619939
complement(6519)-dbSNP:
complement(6519)-c, adbSNP:201411796
complement(6521)-t, cdbSNP:144360241
complement(6531)-t, cdbSNP:144704318
complement(6537)-t, cdbSNP:1276712
complement(6542)-g, adbSNP:199915629
complement(6551)-t, cdbSNP:139179818
complement(6574)-g, adbSNP:147267433
complement(6582)-t, cdbSNP:200900185
complement(6612)-g, adbSNP:143899993
complement(6613)-t, cdbSNP:11254278
complement(6634)-t, cdbSNP:150129378
complement(6665)-t, cdbSNP:140883483
complement(6671)-t, cdbSNP:148058933
complement(6693)-t, cdbSNP:143465621
complement(6696)-t, adbSNP:140226156
complement(6707)-t, cdbSNP:146703141
complement(6713)-t, cdbSNP:143291127
complement(6725)-g, cdbSNP:140862613
complement(6817)-t, cdbSNP:145355417
complement(6832)-g, cdbSNP:150035126
complement(6840)-c, adbSNP:2271460
complement(6892)-dbSNP:
complement(6892)-c, adbSNP:144650268
complement(6899)-g, adbSNP:150117913
complement(6908)-c, adbSNP:140737368
complement(6976)-t, adbSNP:115303408
complement(6990)-t, adbSNP:140806389
complement(7011)-t, cdbSNP:148100631
complement(7029)-c, adbSNP:144085030
complement(7030)-t, cdbSNP:200190000
complement(7049)-t, cdbSNP:149507036
complement(7114)-t, cdbSNP:138105853
complement(7158)-c, adbSNP:200593316
complement(7159)-t, cdbSNP:145537365
complement(7164)-g, adbSNP:141819241
complement(7228)-t, cdbSNP:201856719
complement(7235)-t, cdbSNP:138534919
complement(7286..7287)-dbSNP:
complement(7286..7287)-, cdbSNP:35529855
complement(7351)-g, cdbSNP:201002903
complement(7352)-t, cdbSNP:144565631
complement(7383)-t, cdbSNP:11254274
complement(7398)-g, c, adbSNP:41301097
complement(7414)-t, cdbSNP:200248284
complement(7417)-t, adbSNP:117128556
complement(7431)-g, adbSNP:143783280
complement(7452)-t, cdbSNP:200197243
complement(7458)-t, gdbSNP:202229367
complement(7479)-t, cdbSNP:201485176
complement(7481)-t, cdbSNP:201018798
complement(7486)-g, adbSNP:148976047
complement(7487)-t, cdbSNP:145799931
complement(7506)-g, adbSNP:199841930
complement(7507)-t, cdbSNP:144942741
complement(7543)-t, cdbSNP:189314395
complement(7549)-t, cdbSNP:200254154
complement(7560)-g, adbSNP:140983139
complement(7561)-t, cdbSNP:201001705
complement(7574)-t, cdbSNP:147667741
complement(7597)-dbSNP:
complement(7597)-g, adbSNP:185527873
complement(7620)-g, adbSNP:145347743
complement(7714)-g, adbSNP:3740165
complement(7720)-g, adbSNP:150846323
complement(7721)-t, cdbSNP:202089701
complement(7748)-t, cdbSNP:199864467
complement(7752)-t, cdbSNP:201036060
complement(7763)-t, cdbSNP:141748719
complement(7776)-g, cdbSNP:3740168
complement(7784)-g, adbSNP:146232457
complement(7842)-g, adbSNP:141860307
complement(7849)-g, adbSNP:138758085
complement(7885)-t, gdbSNP:200171751
complement(7889)-t, gdbSNP:144626884
complement(7920)-t, gdbSNP:115449747
complement(7953)-t, cdbSNP:112158219
complement(7958)-g, adbSNP:137998687
complement(7965)-dbSNP:
complement(7965)-c, adbSNP:150330148
complement(8023)-t, cdbSNP:140160866
complement(8068)-g, adbSNP:151303316
complement(8073)-t, cdbSNP:184746130
complement(8123)-dbSNP:
complement(8123)-g, adbSNP:1801237
complement(8136)-t, cdbSNP:142667203
complement(8191)-t, gdbSNP:147742103
complement(8202)-g, cdbSNP:2796835
complement(8213)-c, adbSNP:200221369
complement(8233)-g, adbSNP:148502078
complement(8255)-dbSNP:
complement(8255)-c, adbSNP:149802222
complement(8270)-t, cdbSNP:139733084
complement(8342)-g, adbSNP:146256983
complement(8424)-c, adbSNP:112227291
complement(8434)-g, adbSNP:200808196
complement(8451)-g, adbSNP:141737312
complement(8464)-dbSNP:
complement(8464)-g, adbSNP:139990077
complement(8467)-g, adbSNP:199526879
complement(8492)-g, cdbSNP:146024483
complement(8523)-t, cdbSNP:141773881
complement(8530)-g, adbSNP:147986316
complement(8553)-g, adbSNP:144422027
complement(8578)-g, cdbSNP:192775509
complement(8591)-t, adbSNP:149272796
complement(8617)-g, adbSNP:201227730
complement(8630)-g, adbSNP:138719573
complement(8644)-g, adbSNP:199733240
complement(8645)-t, cdbSNP:146847375
complement(8669)-dbSNP:
complement(8669)-t, cdbSNP:142519035
complement(8687)-c, adbSNP:1801238
complement(8708)-t, cdbSNP:200235278
complement(8723)-t, cdbSNP:150488625
complement(8736)-t, cdbSNP:140816574
complement(8753)-t, cdbSNP:201093611
complement(8791)-g, adbSNP:140586269
complement(8793)-g, adbSNP:45551835
complement(8794)-t, cdbSNP:142563433
complement(8801)-t, cdbSNP:142248018
complement(8813..8814)-, cdbSNP:36048939
complement(8854)-t, cdbSNP:149176029
complement(8882)-t, cdbSNP:146572783
complement(8903)-t, cdbSNP:143409222
complement(8912)-g, cdbSNP:139931862
complement(8927)-g, adbSNP:202076095
complement(8943)-g, cdbSNP:148348845
complement(8946)-g, adbSNP:117620008
complement(8954)-g, cdbSNP:45569534
complement(8989)-dbSNP:
complement(8989)-g, adbSNP:150730481
complement(9002)-g, adbSNP:1801239
complement(9020)-t, cdbSNP:115888073
complement(9023)-t, adbSNP:147160034
complement(9057)-g, adbSNP:1801240
complement(9082)-t, cdbSNP:1801241
complement(9087)-g, adbSNP:143741363
complement(9113)-t, cdbSNP:41289299
complement(9130)-g, adbSNP:140524729
complement(9131)-t, cdbSNP:150202444
complement(9177)-t, cdbSNP:142581908
complement(9202)-g, adbSNP:138093299
complement(9217)-g, adbSNP:146539020
complement(9256)-g, adbSNP:117755237
complement(9258)-g, adbSNP:117400821
complement(9259)-t, g, adbSNP:117936668
complement(9260)-t, cdbSNP:144314567
complement(9268)-g, adbSNP:200089816
complement(9319)-dbSNP:
complement(9319)-g, adbSNP:200124646
complement(9339)-g, adbSNP:200493269
complement(9349)-g, adbSNP:140575464
complement(9350)-t, cdbSNP:202189846
complement(9374)-, gdbSNP:35944983
complement(9387)-g, adbSNP:150985118
complement(9392)-t, cdbSNP:117035284
complement(9402)-c, adbSNP:184750323
complement(9470)-t, cdbSNP:148491916
complement(9471)-g, adbSNP:193182652
complement(9477)-t, cdbSNP:199561597
complement(9543)-g, cdbSNP:57163243
complement(9577)-t, cdbSNP:199499934
complement(9617)-t, cdbSNP:111265129
complement(9633)-t, adbSNP:140316361
complement(9649)-g, adbSNP:200457480
complement(9656)-t, cdbSNP:147130832
complement(9719)-dbSNP:
complement(9719)-g, adbSNP:143533714
complement(9741)-g, adbSNP:139511152
complement(9753)-g, cdbSNP:150890299
complement(9766)-g, adbSNP:141513734
complement(9779)-g, cdbSNP:200876086
complement(9810)-g, adbSNP:142446396
complement(9817)-t, cdbSNP:199730617
complement(9845)-t, cdbSNP:181069086
complement(9895)-dbSNP:
complement(9895)-g, adbSNP:703064
complement(9949)-t, cdbSNP:143405367
complement(9967)-g, adbSNP:143027674
complement(9979)-g, cdbSNP:202234356
complement(10038)-g, adbSNP:74431427
complement(10039)-t, cdbSNP:80308930
complement(10050)-g, adbSNP:140637500
complement(10054)-g, cdbSNP:147330179
complement(10080)-g, adbSNP:150358307
complement(10090)-dbSNP:
complement(10090)-g, adbSNP:113079734
complement(10091)-t, cdbSNP:146027947
complement(10118)-t, cdbSNP:144531829
complement(10128)-g, adbSNP:140566726
complement(10129)-t, g, cdbSNP:147563157
complement(10134)-t, adbSNP:200790075
complement(10148)-g, adbSNP:201541523
complement(10149)-g, cdbSNP:201157846
complement(10157)-t, cdbSNP:145023719
complement(10171)-t, gdbSNP:139596037
complement(10285)-t, cdbSNP:144484373
complement(10297)-g, adbSNP:147730705
complement(10302)-t, cdbSNP:145647391
complement(10308)-t, adbSNP:141890166
complement(10317)-t, cdbSNP:1801230
complement(10319)-t, cdbSNP:145872906
complement(10329)-g, cdbSNP:143066121
complement(10334)-g, adbSNP:117570588
complement(10347)-g, cdbSNP:7898873
complement(10403)-t, cdbSNP:145661638
complement(10435)-dbSNP:
complement(10435)-g, adbSNP:141937843
complement(10449)-g, adbSNP:148331476
complement(10486)-g, cdbSNP:142481042
complement(10514)-g, adbSNP:201426128
complement(10544)-g, adbSNP:181848786
complement(10545)-t, cdbSNP:143300012
complement(10581)-dbSNP:
complement(10581)-t, cdbSNP:149155134
complement(10627)-g, adbSNP:145569358
complement(10628)-t, cdbSNP:200330356
complement(10693)-t, cdbSNP:145909413
complement(10696)-t, adbSNP:142314056
complement(10708)-g, c, adbSNP:1801232
complement(10766)-g, adbSNP:145057308
complement(10781)-t, cdbSNP:139051724
complement(10811)-t, cdbSNP:201484266
complement(10886)-dbSNP:
complement(10886)-g, adbSNP:151134377
complement(10887)-t, cdbSNP:142120325
complement(10890)-t, cdbSNP:148626202
complement(10897)-g, adbSNP:146137990
complement(10969)-g, adbSNP:7085076
complement(11017)-t, gdbSNP:111644764
complement(11027)-t, cdbSNP:141485402
complement(11058)-t, cdbSNP:780636
complement(11075)-t, cdbSNP:76742384
complement(11158)-g, adbSNP:185457282
complement(11229)-c, adbSNP:143326344
complement(11254)-t, g, cdbSNP:181630914
complement(11304)-g, adbSNP:188873973
complement(11336)-t, cdbSNP:187251339
complement(11344)-g, adbSNP:182278265
complement(11345)-t, cdbSNP:189192228
complement(11455)-t, gdbSNP:12262227
complement(11484)-g, adbSNP:45565931
complement(11488)-g, cdbSNP:184284227
complement(11525)-t, cdbSNP:780635
complement(11583)-g, adbSNP:191394461
complement(11597)-g, cdbSNP:114778732
complement(11661)-g, adbSNP:114039309
complement(11693)-t, cdbSNP:149618660
complement(11705)-g, adbSNP:115080396
complement(11756)-t, adbSNP:7907825
complement(11796)-g, adbSNP:116825641
complement(11913)-t, adbSNP:188871308
Gene SymbolCUBN
Gene Synonymgp280; IFCR; MGA1
Chromosome10
Locus Map10p12.31
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001081 Homo sapiens cubilin (intrinsic factor-cobalamin receptor) (CUBN), mRNA. Full Length Quote
ORF Sequence Quote
Title Cubilin is expressed in rat and human glomerular podocytes .
Author Prabakaran,T., Christensen,E.I., Nielsen,R. and Verroust,P.J.
Journal Nephrol. Dial. Transplant. 27 (8), 3156-3159 (2012)
Title Acute endotoxemia in mice induces downregulation of megalin and cubilin in the kidney .
Author Schreiber,A., Theilig,F., Schweda,F. and Hocherl,K.
Journal Kidney Int. 82 (1), 53-59 (2012)
Title Inherited cobalamin malabsorption. Mutations in three genes reveal functional and ethnic patterns .
Author Tanner,S.M., Sturm,A.C., Baack,E.C., Liyanarachchi,S. and de la Chapelle,A.
Journal Orphanet J Rare Dis 7, 56 (2012)
Title Associations between single nucleotide polymorphisms in iron-related genes and iron status in multiethnic populations .
Author McLaren,C.E., McLachlan,S., Garner,C.P., Vulpe,C.D., Gordeuk,V.R., Eckfeldt,J.H., Adams,P.C., Acton,R.T., Murray,J.A., Leiendecker-Foster,C., Snively,B.M., Barcellos,L.F., Cook,J.D. and McLaren,G.D.
Journal PLoS ONE 7 (6), E38339 (2012)
Title CUBN as a novel locus for end-stage renal disease: insights from renal transplantation .
Author Reznichenko,A., Snieder,H., van den Born,J., de Borst,M.H., Damman,J., van Dijk,M.C., van Goor,H., Hepkema,B.G., Hillebrands,J.L., Leuvenink,H.G., Niesing,J., Bakker,S.J., Seelen,M. and Navis,G.
Journal PLoS ONE 7 (5), E36512 (2012)
Title Myeloma light chains are ligands for cubilin (gp280) .
Author Batuman,V., Verroust,P.J., Navar,G.L., Kaysen,J.H., Goda,F.O., Campbell,W.C., Simon,E., Pontillon,F., Lyles,M., Bruno,J. and Hammond,T.G.
Journal Am. J. Physiol. 275 (2 PT 2), F246-F254 (1998)
Title The human intrinsic factor-vitamin B12 receptor, cubilin: molecular characterization and chromosomal mapping of the gene to 10p within the autosomal recessive megaloblastic anemia (MGA1) region .
Author Kozyraki,R., Kristiansen,M., Silahtaroglu,A., Hansen,C., Jacobsen,C., Tommerup,N., Verroust,P.J. and Moestrup,S.K.
Journal Blood 91 (10), 3593-3600 (1998)
Title The intrinsic factor-vitamin B12 receptor and target of teratogenic antibodies is a megalin-binding peripheral membrane protein with homology to developmental proteins .
Author Moestrup,S.K., Kozyraki,R., Kristiansen,M., Kaysen,J.H., Rasmussen,H.H., Brault,D., Pontillon,F., Goda,F.O., Christensen,E.I., Hammond,T.G. and Verroust,P.J.
Journal J. Biol. Chem. 273 (9), 5235-5242 (1998)
Title Characterization of an epithelial approximately 460-kDa protein that facilitates endocytosis of intrinsic factor-vitamin B12 and binds receptor-associated protein .
Author Birn,H., Verroust,P.J., Nexo,E., Hager,H., Jacobsen,C., Christensen,E.I. and Moestrup,S.K.
Journal J. Biol. Chem. 272 (42), 26497-26504 (1997)
Title The CUB domain. A widespread module in developmentally regulated proteins .
Author Bork,P. and Beckmann,G.
Journal J. Mol. Biol. 231 (2), 539-545 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878