• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23012 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu23012C Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001083962.1, 145312266
Length 2016 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA.
Product transcription factor 4 isoform a
Comment

Summary: This gene encodes transcription factor 4, a basic helix-loop-helix transcription factor. The encoded protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. This gene is broadly expressed, and may play an important role in nervous system development. Defects in this gene are a cause of Pitt-Hopkins syndrome. Multiple alternatively spliced transcript variants that encode different proteins have been described. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (1) differs in the 5' UTR and coding sequence compared to variant 3. The resulting isoform (a, also known as TCF4-B+) is shorter at the N-terminus compared to isoform c.


Sequence Note: This gene is distinct from TCF7L2 (alias TCF-4).

RefSeq NP_001077431.1
CDS 613..2628
Misc Feature(1)538..540
Misc Feature(2)613..861
Misc Feature(3)613..861
Misc Feature(4)664..690
Misc Feature(5)1747..1812
Misc Feature(6)2155..2157
Misc Feature(7)2308..2490
Misc Feature(8)order(2317..2322,2338..2346,2350..2352,2419..2421,
Misc Feature(9)2341..2343
Misc Feature(10)order(2359..2364,2371..2376,2380..2385,2434..2436,
Misc Feature(11)2479..2550
Exon (1)1..592
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (2)593..684
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (3)685..757
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (4)758..819
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (5)820..916
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (6)917..981
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (7)982..1111
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (8)1112..1161
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (9)1162..1267
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (10)1268..1401
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (11)1402..1534
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (12)1535..1602
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (13)1603..1681
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (14)1682..1758
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (15)1759..1962
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (16)1963..2098
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (17)2099..2261
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (18)2262..2491
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (19)2492..2632
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Exon (20)2633..8332
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Translation MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWG NGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQG CHQQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGL PSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAG MLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTA VWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQ SATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD IKSITRSRSSNNDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLK SDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPG MGDASNHMGQM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(39)-dbSNP:
complement(39)-t, cdbSNP:141229144
complement(160)-t, cdbSNP:113395332
complement(592)-g, cdbSNP:113414846
complement(648)-g, cdbSNP:373774656
complement(696)-dbSNP:
complement(696)-c, adbSNP:199540114
complement(792)-dbSNP:
complement(792)-t, cdbSNP:151203913
complement(798)-t, adbSNP:369630179
complement(821)-dbSNP:
complement(821)-t, cdbSNP:200359873
complement(828)-t, gdbSNP:373658921
842+c, tdbSNP:76646268
complement(850)-t, cdbSNP:113943820
complement(881)-t, cdbSNP:143244149
complement(903)-g, adbSNP:371224890
complement(934)-dbSNP:
complement(934)-g, adbSNP:112222111
complement(953)-t, cdbSNP:139876825
complement(1024)-dbSNP:
complement(1024)-t, cdbSNP:146412750
complement(1026)-g, cdbSNP:201061418
complement(1045)-c, adbSNP:373731942
complement(1078)-t, gdbSNP:200889338
complement(1116)-dbSNP:
complement(1116)-t, cdbSNP:370160994
1126..1129+, aaagdbSNP:398123561
complement(1182)-dbSNP:
complement(1182)-g, adbSNP:367559245
complement(1188)-t, gdbSNP:143993583
complement(1196)-t, cdbSNP:148573556
complement(1206)-t, cdbSNP:368553922
complement(1216)-g, adbSNP:144835402
complement(1229)-g, adbSNP:375899327
complement(1236)-g, cdbSNP:370453680
complement(1272)-dbSNP:
complement(1272)-g, adbSNP:149861305
complement(1299)-t, gdbSNP:200800656
complement(1318)-g, cdbSNP:139859596
complement(1379)-g, cdbSNP:147305084
complement(1396)-g, adbSNP:374521549
complement(1409)-dbSNP:
complement(1409)-g, adbSNP:201776550
complement(1419)-g, adbSNP:143896861
complement(1428)-g, adbSNP:138403996
complement(1548)-dbSNP:
complement(1548)-g, adbSNP:368270265
complement(1556)-g, adbSNP:147445499
complement(1557)-g, adbSNP:200115299
complement(1578)-g, adbSNP:142998298
complement(1644)-dbSNP:
complement(1644)-g, adbSNP:372738049
complement(1677)-g, adbSNP:370880099
1698+dbSNP:
1698+a, gdbSNP:398123560
complement(1699)-g, adbSNP:113615316
complement(1723)-c, adbSNP:75109886
complement(1725)-t, cdbSNP:148308964
1765+dbSNP:
1765+c, tdbSNP:121909122
complement(1769)-g, adbSNP:143594544
complement(1806)-g, adbSNP:200225114
complement(1830)-g, adbSNP:201481787
complement(1857)-g, adbSNP:148909575
complement(1868)-t, cdbSNP:373097472
complement(1895)-c, adbSNP:186508321
complement(1898)-g, adbSNP:180788300
complement(1929)-g, adbSNP:200112082
complement(1962)-t, cdbSNP:11660217
complement(1966)-dbSNP:
complement(1966)-t, cdbSNP:138570124
complement(2031)-g, cdbSNP:143944746
complement(2080)-t, gdbSNP:375511149
complement(2150)-dbSNP:
complement(2150)-g, adbSNP:112174081
complement(2163)-g, adbSNP:140862252
complement(2189)-g, adbSNP:202025804
complement(2203)-t, cdbSNP:374942035
complement(2220)-g, adbSNP:370405835
complement(2263)-dbSNP:
complement(2263)-t, cdbSNP:146454287
complement(2295)-t, cdbSNP:71368997
complement(2316)-t, cdbSNP:144068462
2345+c, gdbSNP:121909123
2350+c, tdbSNP:121909120
2351+a, gdbSNP:121909121
complement(2454)-t, cdbSNP:369262048
complement(2478)-t, cdbSNP:140078086
complement(2508)-dbSNP:
complement(2508)-t, cdbSNP:200096408
complement(2517)-t, cdbSNP:151150677
complement(2535)-t, cdbSNP:76956936
2553+a, gdbSNP:8766
complement(2564)-g, cdbSNP:148802110
complement(2577)-g, adbSNP:147289056
complement(2650)-dbSNP:
complement(2650)-t, cdbSNP:182372608
complement(2663)-t, adbSNP:190089558
complement(2672)-t, gdbSNP:375952379
complement(2681)-t, gdbSNP:111947783
complement(2722)-g, cdbSNP:141586028
complement(2822..2823)-, tdbSNP:201242245
complement(2996)-c, adbSNP:2510126
complement(3034)-c, adbSNP:1610858
complement(3079)-t, cdbSNP:115039389
3093+g, tdbSNP:1614894
complement(3177)-t, cdbSNP:148367822
complement(3256..3257)-, tdbSNP:34674967
complement(3336)-t, adbSNP:186018055
complement(3401..3402)-, aadbSNP:59885579
complement(3414..3415)-, aadbSNP:375140529
complement(3415)-c, adbSNP:200670559
complement(3416)-c, adbSNP:199626082
complement(3434)-g, adbSNP:1799410
complement(3460)-c, adbSNP:181670668
complement(3537)-t, cdbSNP:143242430
complement(3768)-t, gdbSNP:200323049
complement(3770)-t, cdbSNP:201446935
complement(3809)-g, adbSNP:114103361
complement(3967..3968)-, adbSNP:145712320
complement(4204)-g, adbSNP:190738599
complement(4389)-, tdbSNP:71674214
complement(4390)-g, adbSNP:375041498
complement(4427)-g, cdbSNP:187063308
complement(4447)-t, cdbSNP:375527212
complement(4517)-c, adbSNP:180957404
complement(4531)-t, cdbSNP:117913194
complement(4629)-c, adbSNP:201139617
complement(4630..4631)-, adbSNP:374574975
complement(4637..4638)-, adbSNP:141970461
complement(4638)-t, adbSNP:199997595
complement(4643..4644)-, tdbSNP:201595158
complement(4658)-t, cdbSNP:373331185
complement(4822)-t, cdbSNP:188114891
complement(4951)-g, adbSNP:149550105
complement(5040)-g, adbSNP:183775022
complement(5041)-t, cdbSNP:191924864
complement(5181)-g, adbSNP:117874302
complement(5182)-t, cdbSNP:138367243
complement(5185)-c, adbSNP:375595325
complement(5212)-g, adbSNP:145683381
5288+c, tdbSNP:140356463
complement(5316)-t, cdbSNP:188623567
complement(5330..5332)-, actdbSNP:150498725
complement(5376)-g, cdbSNP:146732738
complement(5475)-t, cdbSNP:184649772
complement(5485)-g, adbSNP:150131510
complement(5542)-t, cdbSNP:368588962
complement(5579)-t, cdbSNP:76640061
complement(5588)-t, cdbSNP:9951787
complement(5603)-t, cdbSNP:140889470
5719+a, cdbSNP:1787800
complement(5759)-t, cdbSNP:374365683
complement(5876)-t, cdbSNP:370745475
complement(5897)-t, adbSNP:192850080
complement(5911)-t, cdbSNP:150998314
complement(6024..6025)-, adbSNP:371245490
complement(6025)-t, adbSNP:111302418
complement(6046..6047)-, adbSNP:147548324
complement(6119)-g, adbSNP:185402957
6365+g, tdbSNP:11429
complement(6377)-g, adbSNP:192719779
complement(6485)-t, cdbSNP:76245439
complement(6498)-, tdbSNP:66807288
complement(6533)-c, adbSNP:2510125
complement(6565)-c, adbSNP:11559223
complement(6566)-t, cdbSNP:186817281
complement(6610)-, tdbSNP:35555522
complement(6689..6690)-, tdbSNP:140440103
complement(6694)-t, gdbSNP:199992799
complement(6695)-t, adbSNP:201624291
complement(6716)-g, adbSNP:182171482
6842+g, tdbSNP:1049482
6848+g, tdbSNP:1049483
complement(6886)-t, gdbSNP:190235846
complement(6935..6936)-, tdbSNP:144800392
6946..6947+a, gdbSNP:1063384
complement(6946..6947)-, ct, tcdbSNP:61382440
complement(6946)-t, cdbSNP:370819816
complement(6947..6948)-, tcdbSNP:373174214
complement(6953..6954)-, ttdbSNP:369444573
6953+a, gdbSNP:1272363
complement(6957)-t, cdbSNP:1799409
complement(6967..6969)-, tttdbSNP:59238025
complement(6968)-t, gdbSNP:77239765
complement(6970)-t, gdbSNP:78681064
complement(6980..6981)-, ttdbSNP:11431395
complement(7065)-g, cdbSNP:61524834
complement(7158)-t, cdbSNP:116613924
complement(7249)-g, adbSNP:78248109
complement(7303)-t, gdbSNP:186919387
7340+c, tdbSNP:1261083
complement(7349..7350)-, tdbSNP:372827426
complement(7421)-t, cdbSNP:183750797
7647+a, gdbSNP:140368699
7734+c, tdbSNP:1261084
7927+a, gdbSNP:1261085
complement(7987)-t, cdbSNP:144794486
complement(7997)-g, adbSNP:75090842
complement(8169)-t, adbSNP:77046538
complement(8181..8182)-, adbSNP:71670792
8323+a, cdbSNP:3178193
Gene SymbolTCF4
Gene SynonymbHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Chromosome18
Locus Map18q21.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. On-demand $279.00 12-14
Title Association and familial segregation of CTG18.1 trinucleotide repeat expansion of TCF4 gene in Fuchs' endothelial corneal dystrophy .
Author Mootha VV, Gong X, Ku HC and Xing C.
Journal Invest. Ophthalmol. Vis. Sci. 55 (1), 33-42 (2014)
Title Epstein-Barr virus induces global changes in cellular mRNA isoform usage that are important for the maintenance of latency .
Author Homa NJ, Salinas R, Forte E, Robinson TJ, Garcia-Blanco MA and Luftig MA.
Journal J. Virol. 87 (22), 12291-12301 (2013)
Title Mutations in AGBL1 cause dominant late-onset Fuchs corneal dystrophy and alter protein-protein interaction with TCF4 .
Author Riazuddin SA, Vasanth S, Katsanis N and Gottsch JD.
Journal Am. J. Hum. Genet. 93 (4), 758-764 (2013)
Title Genome-wide association analysis identifies 13 new risk loci for schizophrenia .
Author Ripke S, O'Dushlaine C, Chambert K, Moran JL, Kahler AK, Akterin S, Bergen SE, Collins AL, Crowley JJ, Fromer M, Kim Y, Lee SH, Magnusson PK, Sanchez N, Stahl EA, Williams S, Wray NR, Xia K, Bettella F, Borglum AD, Bulik-Sullivan BK, Cormican P, Craddock N, de Leeuw C, Durmishi N, Gill M, Golimbet V, Hamshere ML, Holmans P, Hougaard DM, Kendler KS, Lin K, Morris DW, Mors O, Mortensen PB, Neale BM, O'Neill FA, Owen MJ, Milovancevic MP, Posthuma D, Powell J, Richards AL, Riley BP, Ruderfer D, Rujescu D, Sigurdsson E, Silagadze T, Smit AB, Stefansson H, Steinberg S, Suvisaari J, Tosato S, Verhage M, Walters JT, Levinson DF, Gejman PV, Kendler KS, Laurent C, Mowry BJ, O'Donovan MC, Owen MJ, Pulver AE, Riley BP, Schwab SG, Wildenauer DB, Dudbridge F, Holmans P, Shi J, Albus M, Alexander M, Campion D, Cohen D, Dikeos D, Duan J, Eichhammer P, Godard S, Hansen M, Lerer FB, Liang KY, Maier W, Mallet J, Nertney DA, Nestadt G, Norton N, O'Neill FA, Papadimitriou GN, Ribble R, Sanders AR, Silverman JM, Walsh D, Williams NM, Wormley B, Arranz MJ, Bakker S, Bender S, Bramon E, Collier D, Crespo-Facorro B, Hall J, Iyegbe C, Jablensky A, Kahn RS, Kalaydjieva L, Lawrie S, Lewis CM, Lin K, Linszen DH, Mata I, McIntosh A, Murray RM, Ophoff RA, Powell J, Rujescu D, Van Os J, Walshe M, Weisbrod M, Wiersma D, Donnelly P, Barroso I, Blackwell JM, Bramon E, Brown MA, Casas JP, Corvin AP, Deloukas P, Duncanson A, Jankowski J, Markus HS, Mathew CG, Palmer CN, Plomin R, Rautanen A, Sawcer SJ, Trembath RC, Viswanathan AC, Wood NW, Spencer CC, Band G, Bellenguez C, Freeman C, Hellenthal G, Giannoulatou E, Pirinen M, Pearson RD, Strange A, Su Z, Vukcevic D, Donnelly P, Langford C, Hunt SE, Edkins S, Gwilliam R, Blackburn H, Bumpstead SJ, Dronov S, Gillman M, Gray E, Hammond N, Jayakumar A, McCann OT, Liddle J, Potter SC, Ravindrarajah R, Ricketts M, Tashakkori-Ghanbaria A, Waller MJ, Weston P, Widaa S, Whittaker P, Barroso I, Deloukas P, Mathew CG, Blackwell JM, Brown MA, Corvin AP, McCarthy MI, Spencer CC, Bramon E, Corvin AP, O'Donovan MC, Stefansson K, Scolnick E, Purcell S, McCarroll SA, Sklar P, Hultman CM and Sullivan PF.
Journal Nat. Genet. 45 (10), 1150-1159 (2013)
Title A comprehensive family-based replication study of schizophrenia genes .
Author Aberg KA, Liu Y, Bukszar J, McClay JL, Khachane AN, Andreassen OA, Blackwood D, Corvin A, Djurovic S, Gurling H, Ophoff R, Pato CN, Pato MT, Riley B, Webb T, Kendler K, O'Donovan M, Craddock N, Kirov G, Owen M, Rujescu D, St Clair D, Werge T, Hultman CM, Delisi LE, Sullivan P and van den Oord EJ.
Journal JAMA Psychiatry 70 (6), 573-581 (2013)
Title Determinants of helix-loop-helix dimerization affinity. Random mutational analysis of SCL/tal .
Author Goldfarb AN, Lewandowska K and Shoham M.
Journal J. Biol. Chem. 271 (5), 2683-2688 (1996)
Title Pitt-Hopkins Syndrome .
Author Ardinger,H.H., Welsh,H.I. and Saunders,C.J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Helix-loop-helix transcriptional activators bind to a sequence in glucocorticoid response elements of retrovirus enhancers .
Author Corneliussen B, Thornell A, Hallberg B and Grundstrom T.
Journal J. Virol. 65 (11), 6084-6093 (1991)
Title Sequence of the cDNA encoding ITF-2, a positive-acting transcription factor .
Author Henthorn P, McCarrick-Walmsley R and Kadesch T.
Journal Nucleic Acids Res. 18 (3), 678 (1990)
Title Two distinct transcription factors that bind the immunoglobulin enhancer microE5/kappa 2 motif .
Author Henthorn P, Kiledjian M and Kadesch T.
Journal Science 247 (4941), 467-470 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.