• THAT   AND
  • THAT   AND


Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. Full Lenth Quote
ORF Sequence $584.64


RefSeq Version NM_001083962.1, 145312266
Length 8332 bp
Structure linear
Update Date 16-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA.
Product transcription factor 4 isoform a
Comment

Summary: This gene encodes transcription factor 4, a basic helix-turn-helix transcription factor. The encoded protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. This gene is expressed predominantly in pre-B-cells, although it is found in other tissues as well. Defects in this gene are a cause of Pitt-Hopkins syndrome. Multiple alternatively spliced transcript variants that encode different proteins have been described. [provided by RefSeq].


Transcript Variant: This variant (1) represents the longer transcript and it encodes the longer protein (isoform a).


Sequence Note: This gene is distinct from TCF7L2 (alias TCF-4).

RefSeq NP_001077431.1
CDS 613..2628
Exon (1)1..592
Exon (2)1..592
Exon (3)593..684
Exon (4)685..757
Exon (5)758..819
Exon (6)820..916
Exon (7)917..981
Exon (8)982..1111
Exon (9)1112..1161
Exon (10)1162..1267
Exon (11)1268..1401
Exon (12)1402..1534
Exon (13)1535..1602
Exon (14)1603..1681
Exon (15)1682..1758
Exon (16)1759..1962
Exon (17)1963..2098
Exon (18)2099..2261
Exon (19)2262..2491
Exon (20)2492..2632
Exon (21)2633..8332
Translation MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWG NGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQG CHQQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGL PSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAG MLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTA VWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQ SATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD IKSITRSRSSNNDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLK SDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPG MGDASNHMGQM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(160)-t, cdbSNP:113395332
complement(592)-g, cdbSNP:113414846
complement(842)-t, cdbSNP:76646268
complement(850)-t, cdbSNP:113943820
complement(934)-g, adbSNP:112222111
complement(1699)-g, adbSNP:113615316
complement(1723)-c, adbSNP:75109886
1765+c, tdbSNP:121909122
complement(1962)-t, cdbSNP:11660217
complement(2150)-g, adbSNP:112174081
complement(2295)-t, cdbSNP:71368997
2345+c, gdbSNP:121909123
2350+c, tdbSNP:121909120
2351+a, gdbSNP:121909121
complement(2535)-t, cdbSNP:76956936
2553+a, gdbSNP:8766
complement(2681)-t, gdbSNP:111947783
complement(2996)-c, adbSNP:2510126
complement(3034)-c, adbSNP:1610858
complement(3079)-t, cdbSNP:115039389
3093+g, tdbSNP:1614894
complement(3133)-c, adbSNP:78459255
complement(3256..3257)-, tdbSNP:34674967
complement(3401..3402)-, aadbSNP:59885579
complement(3415)-c, adbSNP:114034750
complement(3434)-g, adbSNP:1799410
complement(3768)-c, adbSNP:80303209
complement(3770)-t, cdbSNP:116450095
complement(3809)-g, adbSNP:114103361
complement(3898)-g, adbSNP:117502784
complement(4381)-, tdbSNP:71674214
complement(4531)-t, cdbSNP:117913194
complement(4628..4629)-, adbSNP:71761001
complement(4630..4631)-, adbSNP:78776249
complement(4639)-t, adbSNP:77505503
complement(5041)-t, cdbSNP:117362307
complement(5181)-g, adbSNP:117874302
complement(5319..5320)-, tdbSNP:71752871
complement(5579)-t, cdbSNP:76640061
complement(5588)-t, cdbSNP:9951787
5719+a, cdbSNP:1787800
complement(6015)-t, adbSNP:117984440
complement(6025)-t, adbSNP:111302418
complement(6316)-, aaaadbSNP:67530638
6365+g, tdbSNP:11429
complement(6484)-, t, ttdbSNP:72290824
complement(6485)-t, cdbSNP:76245439
complement(6497)-t, cdbSNP:116932210
complement(6498)-, tdbSNP:66807288
complement(6533)-c, adbSNP:2510125
complement(6565)-c, adbSNP:11559223
complement(6610)-, tdbSNP:35555522
6842+g, tdbSNP:1049482
6848+g, tdbSNP:1049483
complement(6927..6928)-, tdbSNP:67958522
complement(6934..6935)-, tdbSNP:71650037
complement(6945..6946)-, ctdbSNP:68066456
complement(6946..6947)-, ctdbSNP:61382440
6947..6948+a, gdbSNP:1063384
6953+, a, gdbSNP:1272363
complement(6957)-t, cdbSNP:1799409
complement(6965..6966)-, tdbSNP:72019269
complement(6966)-t, gdbSNP:117772151
complement(6967..6969)-, tttdbSNP:59238025
complement(6967..6968)-, ttdbSNP:66702122
complement(6968)-t, gdbSNP:77239765
complement(6970)-t, gdbSNP:78681064
complement(6973)-, tdbSNP:71741091
complement(6975..6976)-, tdbSNP:11431395
complement(6981)-, t, tt, tttdbSNP:35309239
complement(6984)-t, adbSNP:74537831
complement(7065)-g, cdbSNP:61524834
complement(7158)-t, cdbSNP:116613924
complement(7249)-g, adbSNP:78248109
7340+c, tdbSNP:1261083
complement(7421)-t, cdbSNP:114758604
7734+c, tdbSNP:1261084
7927+a, gdbSNP:1261085
complement(7997)-g, adbSNP:75090842
complement(8169)-t, adbSNP:77046538
complement(8172..8173)-, adbSNP:71670792
complement(8181..8182)-, adbSNP:113727315
complement(8182)-g, adbSNP:74825530
8323+a, cdbSNP:3178193
Gene SymbolTCF4
Gene SynonymbHLHb19; E2-2; ITF2; MGC149723; MGC149724; PTHS; SEF2; SEF2-1; SEF2-1A; SEF2-1B
Chromosome18
Locus Map18q21.1
All Transcripts NM_001083962 , NM_003199
Title Genome-wide Meta-analysis for Severe Diabetic Retinopathy .
Author Grassi,M.A., Tikhomirov,A., Ramalingam,S., Below,J.E., Cox,N.J. and Nicolae,D.L.
Journal Hum. Mol. Genet. (2011) In press
Title Most genome-wide significant susceptibility loci for schizophrenia and bipolar disorder reported to date cross-traditional diagnostic boundaries .
Author Williams,H.J., Craddock,N., Russo,G., Hamshere,M.L., Moskvina,V., Dwyer,S., Smith,R.L., Green,E., Grozeva,D., Holmans,P., Owen,M.J. and O'Donovan,M.C.
Journal Hum. Mol. Genet. 20 (2), 387-391 (2011)
Title p15RS attenuates Wnt/{beta}-catenin signaling by disrupting {beta}-catenin.TCF4 Interaction .
Author Wu,Y., Zhang,Y., Zhang,H., Yang,X., Wang,Y., Ren,F., Liu,H., Zhai,Y., Jia,B., Yu,J. and Chang,Z.
Journal J. Biol. Chem. 285 (45), 34621-34631 (2010)
Title E2-2 protein and Fuchs's corneal dystrophy .
Author Baratz,K.H., Tosakulwong,N., Ryu,E., Brown,W.L., Branham,K., Chen,W., Tran,K.D., Schmid-Kubista,K.E., Heckenlively,J.R., Swaroop,A., Abecasis,G., Bailey,K.R. and Edwards,A.O.
Journal N. Engl. J. Med. 363 (11), 1016-1024 (2010)
Title NGX6 inhibits cell invasion and adhesion through suppression of Wnt/beta-catenin signal pathway in colon cancer .
Author Guo,Q., Shen,S., Liao,M., Lian,P. and Wang,X.
Journal Acta Biochim. Biophys. Sin. (Shanghai) 42 (7), 450-456 (2010)
Title The helix-loop-helix transcription factor SEF-2 regulates the activity of a novel initiator element in the promoter of the human somatostatin receptor II gene .
Author Pscherer,A., Dorflinger,U., Kirfel,J., Gawlas,K., Ruschoff,J., Buettner,R. and Schule,R.
Journal EMBO J. 15 (23), 6680-6690 (1996)
Title Determinants of helix-loop-helix dimerization affinity. Random mutational analysis of SCL/tal .
Author Goldfarb,A.N., Lewandowska,K. and Shoham,M.
Journal J. Biol. Chem. 271 (5), 2683-2688 (1996)
Title Helix-loop-helix transcriptional activators bind to a sequence in glucocorticoid response elements of retrovirus enhancers .
Author Corneliussen,B., Thornell,A., Hallberg,B. and Grundstrom,T.
Journal J. Virol. 65 (11), 6084-6093 (1991)
Title Sequence of the cDNA encoding ITF-2, a positive-acting transcription factor .
Author Henthorn,P., McCarrick-Walmsley,R. and Kadesch,T.
Journal Nucleic Acids Res. 18 (3), 678 (1990)
Title Two distinct transcription factors that bind the immunoglobulin enhancer microE5/kappa 2 motif .
Author Henthorn,P., Kiledjian,M. and Kadesch,T.
Journal Science 247 (4941), 467-470 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878