• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. ORF Sequence $584.64
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001083962.1, 145312266
Length 8332 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA.
Product transcription factor 4 isoform a
Comment

Summary: This gene encodes transcription factor 4, a basic helix-loop-helix transcription factor. The encoded protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. This gene is broadly expressed, and may play an important role in nervous system development. Defects in this gene are a cause of Pitt-Hopkins syndrome. Multiple alternatively spliced transcript variants that encode different proteins have been described. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (1) differs in the 5' UTR and coding sequence compared to variant 3. The resulting isoform (a, also known as TCF4-B+) is shorter at the N-terminus compared to isoform c.


Sequence Note: This gene is distinct from TCF7L2 (alias TCF-4).

RefSeq NP_001077431.1
CDS 613..2628
Misc Feature(1)538..540
Misc Feature(2)613..861
Misc Feature(3)613..861
Misc Feature(4)664..690
Misc Feature(5)1747..1812
Misc Feature(6)2155..2157
Misc Feature(7)2308..2490
Misc Feature(8)order(2317..2322,2338..2346,2350..2352,2419..2421,
Misc Feature(9)2341..2343
Misc Feature(10)order(2359..2364,2371..2376,2380..2385,2434..2436,
Misc Feature(11)2479..2550
Exon (1)1..592
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (2)593..684
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (3)685..757
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (4)758..819
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (5)820..916
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (6)917..981
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (7)982..1111
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (8)1112..1161
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (9)1162..1267
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (10)1268..1401
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (11)1402..1534
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (12)1535..1602
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (13)1603..1681
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (14)1682..1758
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (15)1759..1962
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (16)1963..2098
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (17)2099..2261
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (18)2262..2491
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (19)2492..2632
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Exon (20)2633..8332
Gene:TCF4
Gene Synonym:bHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Translation MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWG NGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQG CHQQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGL PSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAG MLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTA VWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQ SATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD IKSITRSRSSNNDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLK SDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPG MGDASNHMGQM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(39)-dbSNP:
complement(39)-t, cdbSNP:141229144
complement(148)-c, adbSNP:148012797
complement(160)-t, cdbSNP:113395332
complement(170)-g, cdbSNP:183934016
complement(198)-g, adbSNP:192011138
complement(274)-g, adbSNP:9675704
complement(275)-t, cdbSNP:9675364
complement(298)-t, gdbSNP:9675363
complement(314)-t, cdbSNP:9675362
complement(320)-c, adbSNP:9675722
complement(330)-g, adbSNP:9675703
complement(370)-g, adbSNP:185247856
complement(494)-g, adbSNP:113811429
complement(592)-g, cdbSNP:113414846
complement(696)-dbSNP:
complement(696)-c, adbSNP:199540114
complement(738)-t, cdbSNP:76118442
complement(792)-dbSNP:
complement(792)-t, cdbSNP:151203913
complement(821)-dbSNP:
complement(821)-t, cdbSNP:200359873
complement(842)-t, cdbSNP:76646268
complement(850)-t, cdbSNP:113943820
complement(881)-t, cdbSNP:143244149
complement(934)-dbSNP:
complement(934)-g, adbSNP:112222111
complement(953)-t, cdbSNP:139876825
complement(1024)-dbSNP:
complement(1024)-t, cdbSNP:146412750
complement(1026)-g, cdbSNP:201061418
complement(1078)-t, gdbSNP:200889338
complement(1188)-dbSNP:
complement(1188)-t, gdbSNP:143993583
complement(1196)-t, cdbSNP:148573556
complement(1216)-g, adbSNP:144835402
complement(1272)-dbSNP:
complement(1272)-g, adbSNP:149861305
complement(1299)-t, gdbSNP:200800656
complement(1318)-g, cdbSNP:139859596
complement(1379)-g, cdbSNP:147305084
complement(1409)-dbSNP:
complement(1409)-g, adbSNP:201776550
complement(1419)-g, adbSNP:143896861
complement(1428)-g, adbSNP:138403996
complement(1556)-dbSNP:
complement(1556)-g, adbSNP:147445499
complement(1557)-g, adbSNP:200115299
complement(1578)-g, adbSNP:142998298
complement(1699)-dbSNP:
complement(1699)-g, adbSNP:113615316
complement(1723)-c, adbSNP:75109886
complement(1725)-t, cdbSNP:148308964
complement(1765)-dbSNP:
complement(1765)-t, cdbSNP:121909122
complement(1769)-g, adbSNP:143594544
complement(1806)-g, adbSNP:200225114
complement(1830)-g, adbSNP:201481787
complement(1857)-g, adbSNP:148909575
complement(1895)-c, adbSNP:186508321
complement(1898)-g, adbSNP:180788300
complement(1929)-g, adbSNP:200112082
complement(1962)-t, cdbSNP:11660217
complement(1966)-dbSNP:
complement(1966)-t, cdbSNP:138570124
complement(2031)-g, cdbSNP:143944746
complement(2150)-dbSNP:
complement(2150)-g, adbSNP:112174081
complement(2163)-g, adbSNP:140862252
complement(2189)-g, adbSNP:202025804
complement(2263)-dbSNP:
complement(2263)-t, cdbSNP:146454287
complement(2295)-t, cdbSNP:71368997
complement(2316)-t, cdbSNP:144068462
complement(2345)-g, cdbSNP:121909123
complement(2350)-t, cdbSNP:121909120
complement(2351)-g, adbSNP:121909121
complement(2478)-t, cdbSNP:140078086
complement(2508)-dbSNP:
complement(2508)-t, cdbSNP:200096408
complement(2517)-t, cdbSNP:151150677
complement(2535)-t, cdbSNP:76956936
complement(2553)-g, adbSNP:8766
complement(2564)-g, cdbSNP:148802110
complement(2577)-g, adbSNP:147289056
complement(2650)-dbSNP:
complement(2650)-t, cdbSNP:182372608
complement(2663)-t, adbSNP:190089558
complement(2681)-t, gdbSNP:111947783
complement(2722)-g, cdbSNP:141586028
complement(2822..2823)-, tdbSNP:201242245
complement(2996)-c, adbSNP:2510126
complement(3034)-c, adbSNP:1610858
complement(3079)-t, cdbSNP:115039389
complement(3093)-t, gdbSNP:1614894
complement(3177)-t, cdbSNP:148367822
complement(3257..3258)-, tdbSNP:34674967
complement(3336)-t, adbSNP:186018055
complement(3413..3414)-, aadbSNP:59885579
complement(3415)-c, adbSNP:200670559
complement(3416)-c, adbSNP:199626082
complement(3434)-g, adbSNP:1799410
complement(3460)-c, adbSNP:181670668
complement(3537)-t, cdbSNP:143242430
complement(3768)-t, gdbSNP:200323049
complement(3770)-t, cdbSNP:201446935
complement(3809)-g, adbSNP:114103361
complement(3967..3968)-, adbSNP:145712320
complement(4204)-g, adbSNP:190738599
complement(4389)-, tdbSNP:71674214
complement(4427)-g, cdbSNP:187063308
complement(4517)-c, adbSNP:180957404
complement(4531)-t, cdbSNP:117913194
complement(4629..4630)-, adbSNP:201094995
complement(4629)-c, adbSNP:201139617
complement(4637..4638)-, adbSNP:71761001
complement(4638..4639)-, adbSNP:141970461
complement(4638)-t, adbSNP:199997595
complement(4643..4644)-, tdbSNP:201595158
complement(4822)-t, cdbSNP:188114891
complement(4951)-g, adbSNP:149550105
complement(5040)-g, adbSNP:183775022
complement(5041)-t, cdbSNP:191924864
complement(5181)-g, adbSNP:117874302
complement(5182)-t, cdbSNP:138367243
complement(5212)-g, adbSNP:145683381
complement(5288)-t, cdbSNP:140356463
complement(5316)-t, cdbSNP:188623567
complement(5319..5320)-, tdbSNP:71752871
complement(5330..5332)-, actdbSNP:150498725
complement(5376)-g, cdbSNP:146732738
complement(5475)-t, cdbSNP:184649772
complement(5485)-g, adbSNP:150131510
complement(5579)-t, cdbSNP:76640061
complement(5588)-t, cdbSNP:9951787
complement(5603)-t, cdbSNP:140889470
complement(5719)-c, adbSNP:1787800
complement(5897)-t, adbSNP:192850080
complement(5911)-t, cdbSNP:150998314
complement(6025)-t, adbSNP:111302418
complement(6046..6047)-, adbSNP:147548324
complement(6119)-g, adbSNP:185402957
complement(6316)-, aaaadbSNP:67530638
complement(6365)-t, gdbSNP:11429
complement(6377)-g, adbSNP:192719779
complement(6484)-, t, ttdbSNP:72290824
complement(6485)-t, cdbSNP:76245439
complement(6498)-, tdbSNP:66807288
complement(6533)-c, adbSNP:2510125
complement(6565)-c, adbSNP:11559223
complement(6566)-t, cdbSNP:186817281
complement(6610)-, tdbSNP:35555522
complement(6689..6690)-, tdbSNP:140440103
complement(6694)-t, gdbSNP:199992799
complement(6695)-t, adbSNP:201624291
complement(6716)-g, adbSNP:182171482
complement(6842)-t, gdbSNP:1049482
complement(6848)-t, gdbSNP:1049483
complement(6886)-t, gdbSNP:190235846
complement(6934..6935)-, tdbSNP:67958522
complement(6935..6936)-, tdbSNP:144800392
complement(6945..6946)-, ctdbSNP:68066456
complement(6946..6947)-, ct, tcdbSNP:61382440
complement(6947..6948)-g, adbSNP:1063384
complement(6953)-g, adbSNP:1272363
complement(6957)-t, cdbSNP:1799409
complement(6968)-t, gdbSNP:77239765
complement(6970)-t, gdbSNP:78681064
complement(6979..6981)-, tttdbSNP:59238025
complement(6980..6981)-, t, ttdbSNP:11431395
complement(6981)-, tdbSNP:71741091
complement(6981)-, t, tt, tttdbSNP:35309239
complement(7065)-g, cdbSNP:61524834
complement(7158)-t, cdbSNP:116613924
complement(7249)-g, adbSNP:78248109
complement(7303)-t, gdbSNP:186919387
complement(7340)-t, cdbSNP:1261083
complement(7421)-t, cdbSNP:183750797
complement(7647)-g, adbSNP:140368699
complement(7734)-t, cdbSNP:1261084
complement(7927)-g, adbSNP:1261085
complement(7987)-t, cdbSNP:144794486
complement(7997)-g, adbSNP:75090842
complement(8168..8169)-, adbSNP:200000964
complement(8169)-t, adbSNP:77046538
complement(8180..8181)-, adbSNP:71670792
complement(8181..8182)-, adbSNP:113727315
complement(8323)-c, adbSNP:3178193
Gene SymbolTCF4
Gene SynonymbHLHb19; E2-2; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; TCF-4
Chromosome18
Locus Map18q21.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001083962 Homo sapiens transcription factor 4 (TCF4), transcript variant 1, mRNA. Full Length Quote
ORF Sequence $584.64
NM_001243226 Homo sapiens transcription factor 4 (TCF4), transcript variant 3, mRNA. Full Length Quote
ORF Sequence $673.38
NM_001243227 Homo sapiens transcription factor 4 (TCF4), transcript variant 4, mRNA. Full Length Quote
ORF Sequence $563.76
NM_001243228 Homo sapiens transcription factor 4 (TCF4), transcript variant 5, mRNA. Full Length Quote
ORF Sequence $589.86
NM_001243230 Homo sapiens transcription factor 4 (TCF4), transcript variant 6, mRNA. Full Length $3506.85
ORF Sequence $578.55
NM_001243231 Homo sapiens transcription factor 4 (TCF4), transcript variant 7, mRNA. Full Length $3489.30
ORF Sequence $544.62
NM_001243232 Homo sapiens transcription factor 4 (TCF4), transcript variant 8, mRNA. Full Length $3504.60
ORF Sequence $522.87
NM_001243233 Homo sapiens transcription factor 4 (TCF4), transcript variant 9, mRNA. Full Length $3472.65
ORF Sequence $468.06
NM_001243234 Homo sapiens transcription factor 4 (TCF4), transcript variant 10, mRNA. Full Length $3312.45
ORF Sequence $445.44
NM_001243235 Homo sapiens transcription factor 4 (TCF4), transcript variant 11, mRNA. Full Length $3307.05
ORF Sequence $441.96
NM_001243236 Homo sapiens transcription factor 4 (TCF4), transcript variant 12, mRNA. Full Length $3314.25
ORF Sequence $441.96
NM_003199 Homo sapiens transcription factor 4 (TCF4), transcript variant 2, mRNA. Full Length Quote
ORF Sequence $581.16
Title The expression and significance of WWOX and beta-catenin in hepatocellular carcinoma .
Author Li,Y.P., Wu,C.C., Chen,W.T., Huang,Y.C. and Chai,C.Y.
Journal APMIS 121 (2), 120-126 (2013)
Title Genome-wide association analysis in Primary sclerosing cholangitis and ulcerative colitis identifies risk loci at GPR35 and TCF4 .
Author Ellinghaus,D., Folseraas,T., Holm,K., Ellinghaus,E., Melum,E., Balschun,T., Laerdahl,J.K., Shiryaev,A., Gotthardt,D.N., Weismuller,T.J., Schramm,C., Wittig,M., Bergquist,A., Bjornsson,E., Marschall,H.U., Vatn,M., Teufel,A., Rust,C., Gieger,C., Wichmann,H.E., Runz,H., Sterneck,M., Rupp,C., Braun,F., Weersma,R.K., Wijmenga,C., Ponsioen,C.Y., Mathew,C.G., Rutgeerts,P., Vermeire,S., Schrumpf,E., Hov,J.R., Manns,M.P., Boberg,K.M., Schreiber,S., Franke,A. and Karlsen,T.H.
Journal Hepatology (2012) In press
Title Differing roles for TCF4 and COL8A2 in central corneal thickness and fuchs endothelial corneal dystrophy .
Author Igo,R.P. Jr., Kopplin,L.J., Joseph,P., Truitt,B., Fondran,J., Bardenstein,D., Aldave,A.J., Croasdale,C.R., Price,M.O., Rosenwasser,M., Lass,J.H. and Iyengar,S.K.
Journal PLoS ONE 7 (10), E46742 (2012)
Title Inhibition of Tcf-4 induces apoptosis and enhances chemosensitivity of colon cancer cells .
Author Xie,J., Xiang,D.B., Wang,H., Zhao,C., Chen,J., Xiong,F., Li,T.Y. and Wang,X.L.
Journal PLoS ONE 7 (9), E45617 (2012)
Title TCF4 sequence variants and mRNA levels are associated with neurodevelopmental characteristics in psychotic disorders .
Author Wirgenes,K.V., Sonderby,I.E., Haukvik,U.K., Mattingsdal,M., Tesli,M., Athanasiu,L., Sundet,K., Rossberg,J.I., Dale,A.M., Brown,A.A., Agartz,I., Melle,I., Djurovic,S. and Andreassen,O.A.
Journal Transl Psychiatry 2, E112 (2012)
Title The helix-loop-helix transcription factor SEF-2 regulates the activity of a novel initiator element in the promoter of the human somatostatin receptor II gene .
Author Pscherer,A., Dorflinger,U., Kirfel,J., Gawlas,K., Ruschoff,J., Buettner,R. and Schule,R.
Journal EMBO J. 15 (23), 6680-6690 (1996)
Title Determinants of helix-loop-helix dimerization affinity. Random mutational analysis of SCL/tal .
Author Goldfarb,A.N., Lewandowska,K. and Shoham,M.
Journal J. Biol. Chem. 271 (5), 2683-2688 (1996)
Title Helix-loop-helix transcriptional activators bind to a sequence in glucocorticoid response elements of retrovirus enhancers .
Author Corneliussen,B., Thornell,A., Hallberg,B. and Grundstrom,T.
Journal J. Virol. 65 (11), 6084-6093 (1991)
Title Sequence of the cDNA encoding ITF-2, a positive-acting transcription factor .
Author Henthorn,P., McCarrick-Walmsley,R. and Kadesch,T.
Journal Nucleic Acids Res. 18 (3), 678 (1990)
Title Two distinct transcription factors that bind the immunoglobulin enhancer microE5/kappa 2 motif .
Author Henthorn,P., Kiledjian,M. and Kadesch,T.
Journal Science 247 (4941), 467-470 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878