• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA.


RefSeq Accession Definition Services Price Order
NM_001098834 Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA. ORF Sequence $316.68
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001098834.1, 149588929
Length 1324 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA.
Product homeobox protein GBX-1
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AC010973.6.


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.


##Evidence-Data-START## RNAseq introns :: single sample supports all introns ERS025088 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_001092304.1
CDS 233..1324
Misc Feature(1)2..4
Misc Feature(2)2..4
Misc Feature(3)1016..1192
Misc Feature(4)1016..1192
Misc Feature(5)order(1016..1030,1034..1036,1085..1087,1103..1105,
Misc Feature(6)order(1022..1024,1031..1033,1151..1153,1160..1165,
Exon (1)1..770
Gene:GBX1
Gene Synonym:GBX1
Exon (2)771..1324
Gene:GBX1
Gene Synonym:GBX1
Translation MQRAGGGSAPGGNGGGGGGGPGTAFSIDSLIGPPPPRSGHLLYTGYPMFMPYRPLVLPQA LAPAPLPAGLPPLAPLASFAGRLTNTFCAGLGQAVPSMVALTTALPSFAEPPDAFYGPQE LAAAAAAAAATAARNNPEPGGRRPEGGLEADELLPAREKVAEPPPPPPPHFSETFPSLPA EGKVYSSDEEKLEASAGDPAGSEQEEEGSGGDSEDDGFLDSSAGGPGALLGPKPKLKGSL GTGAEEGAPVTAGVTAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKL SEVQVKIWFQNRRAKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQG ARP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(325)-g, cdbSNP:13242341
complement(628)-g, cdbSNP:13241978
complement(634)-t, gdbSNP:193195002
complement(683)-t, cdbSNP:200545413
complement(689)-g, cdbSNP:201650225
complement(751)-c, adbSNP:201756310
complement(812)-dbSNP:
complement(812)-t, cdbSNP:11975799
complement(895)-c, adbSNP:192479027
complement(917)-g, adbSNP:200119934
complement(942)-t, cdbSNP:6970768
complement(978)-g, adbSNP:201395169
complement(1023)-t, cdbSNP:200333232
complement(1088)-g, adbSNP:200785319
complement(1114)-g, adbSNP:201417319
complement(1121)-t, cdbSNP:200609477
complement(1147)-t, gdbSNP:75176255
complement(1212)-t, cdbSNP:199515474
complement(1278)-g, adbSNP:201566761
complement(1283)-g, adbSNP:202046564
Gene SymbolGBX1
Gene SynonymGBX1
Chromosome7
Locus Map7q36.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001098834 Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA. Full Length $383.96
ORF Sequence $316.68
Title cDNA cloning and expression of the human NOBOX gene in oocytes and ovarian follicles .
Author Huntriss,J., Hinkins,M. and Picton,H.M.
Journal Mol. Hum. Reprod. 12 (5), 283-289 (2006)
Title The HOX complex neighbored by the EVX gene, as well as two other homeobox-containing genes, the GBX-class and the EN-class, are located on the same chromosomes 2 and 7 in humans .
Author Matsui,T., Hirai,M., Hirano,M. and Kurosawa,Y.
Journal FEBS Lett. 336 (1), 107-110 (1993)
Title Expression of a novel human homeobox-containing gene that maps to chromosome 7q36.1 in hematopoietic cells .
Author Matsui,T., Hirai,M., Wakita,M., Hirano,M. and Kurosawa,Y.
Journal FEBS Lett. 322 (2), 181-185 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878