• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu01217 Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu01217C Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001098834.2, 533112471
Length 1092 bp
Structure linear
Update Date 18-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA.
Product homeobox protein GBX-1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC010973.7. On Aug 27, 2013 this sequence version replaced gi:149588929.


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.


##Evidence-Data-START## RNAseq introns :: single sample supports all introns ERS025093 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_001092304.1
CDS 1..1092
Misc Feature(1)784..960
Misc Feature(2)784..960
Misc Feature(3)order(784..798,802..804,853..855,871..873,910..912,
Misc Feature(4)order(790..792,799..801,919..921,928..933,940..942)
Exon (1)539..1092
Gene:GBX1
Gene Synonym:Huh-17
Translation MQRAGGGSAPGGNGGGGGGGPGTAFSIDSLIGPPPPRSGHLLYTGYPMFMPYRPLVLPQA LAPAPLPAGLPPLAPLASFAGRLTNTFCAGLGQAVPSMVALTTALPSFAEPPDAFYGPQE LAAAAAAAAATAARNNPEPGGRRPEGGLEADELLPAREKVAEPPPPPPPHFSETFPSLPA EGKVYSSDEEKLEASAGDPAGSEQEEEGSGGDSEDDGFLDSSAGGPGALLGPKPKLKGSL GTGAEEGAPVTAGVTAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKL SEVQVKIWFQNRRAKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQG ARP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(93)-dbSNP:
complement(93)-g, cdbSNP:13242341
complement(396)-g, cdbSNP:13241978
complement(402)-t, gdbSNP:193195002
complement(439)-t, cdbSNP:377469765
complement(451)-t, cdbSNP:200545413
complement(457)-g, cdbSNP:201650225
complement(464)-g, adbSNP:370046549
complement(519)-c, adbSNP:201756310
complement(532)-t, gdbSNP:372158178
complement(536)-g, adbSNP:369810012
complement(537)-g, adbSNP:375522842
complement(580)-dbSNP:
complement(580)-t, cdbSNP:11975799
complement(596)-g, adbSNP:367624740
complement(663)-c, adbSNP:192479027
complement(685)-g, adbSNP:200119934
complement(701)-g, adbSNP:375529208
complement(705)-t, cdbSNP:370970805
complement(710)-t, cdbSNP:6970768
complement(746)-g, adbSNP:201395169
complement(758)-c, adbSNP:374261532
complement(791)-t, cdbSNP:200333232
complement(835)-t, cdbSNP:267601420
complement(856)-g, adbSNP:200785319
complement(882)-g, adbSNP:201417319
complement(889)-t, cdbSNP:200609477
complement(915)-t, gdbSNP:75176255
complement(936)-t, cdbSNP:373562908
complement(952)-g, cdbSNP:368877994
complement(972)-c, adbSNP:376045645
complement(980)-t, cdbSNP:199515474
complement(1046)-g, adbSNP:201566761
complement(1051)-g, adbSNP:202046564
complement(1085)-t, cdbSNP:376566770
Gene SymbolGBX1
Gene SynonymHuh-17
Chromosome7
Locus Map7q36.1
Title cDNA cloning and expression of the human NOBOX gene in oocytes and ovarian follicles .
Author Huntriss J, Hinkins M and Picton HM.
Journal Mol. Hum. Reprod. 12 (5), 283-289 (2006)
Title The HOX complex neighbored by the EVX gene, as well as two other homeobox-containing genes, the GBX-class and the EN-class, are located on the same chromosomes 2 and 7 in humans .
Author Matsui T, Hirai M, Hirano M and Kurosawa Y.
Journal FEBS Lett. 336 (1), 107-110 (1993)
Title Expression of a novel human homeobox-containing gene that maps to chromosome 7q36.1 in hematopoietic cells .
Author Matsui T, Hirai M, Wakita M, Hirano M and Kurosawa Y.
Journal FEBS Lett. 322 (2), 181-185 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.