Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA.
| RefSeq Version | NM_001098834.1, 149588929 |
| Length | 1324 bp |
| Structure | linear |
| Update Date | 12-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA. |
| Product | homeobox protein GBX-1 |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AC010973.6. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. |
| RefSeq | NP_001092304.1 |
| CDS | 233..1324 | Exon (1) | 1..770 | Exon (2) | 1..770 | Exon (3) | 771..1324 |
| Translation | MQRAGGGSAPGGNGGGGGGGPGTAFSIDSLIGPPPPRSGHLLYTGYPMFMPYRPLVLPQA
LAPAPLPAGLPPLAPLASFAGRLTNTFCAGLGQAVPSMVALTTALPSFAEPPDAFYGPQE
LAAAAAAAAATAARNNPEPGGRRPEGGLEADELLPAREKVAEPPPPPPPHFSETFPSLPA
EGKVYSSDEEKLEASAGDPAGSEQEEEGSGGDSEDDGFLDSSAGGPGALLGPKPKLKGSL
GTGAEEGAPVTAGVTAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKL
SEVQVKIWFQNRRAKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQG
ARP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(325) | - | g, c | dbSNP:13242341 |
| complement(628) | - | g, c | dbSNP:13241978 |
| complement(812) | - | t, c | dbSNP:11975799 |
| complement(942) | - | t, c | dbSNP:6970768 |
| complement(1147) | - | t, g | dbSNP:75176255 |
| Gene Symbol | GBX1 |
| Gene Synonym | GBX1 |
| Chromosome | 7 |
| Locus Map | 7q36 |
| All Transcripts | NM_001098834 |
| Title | cDNA cloning and expression of the human NOBOX gene in oocytes and ovarian follicles . |
| Author | Huntriss,J., Hinkins,M. and Picton,H.M. |
| Journal | Mol. Hum. Reprod. 12 (5), 283-289 (2006) |
| Title | The HOX complex neighbored by the EVX gene, as well as two other homeobox-containing genes, the GBX-class and the EN-class, are located on the same chromosomes 2 and 7 in humans . |
| Author | Matsui,T., Hirai,M., Hirano,M. and Kurosawa,Y. |
| Journal | FEBS Lett. 336 (1), 107-110 (1993) |
| Title | Expression of a novel human homeobox-containing gene that maps to chromosome 7q36.1 in hematopoietic cells . |
| Author | Matsui,T., Hirai,M., Wakita,M., Hirano,M. and Kurosawa,Y. |
| Journal | FEBS Lett. 322 (2), 181-185 (1993) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |