• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens Rhox homeobox family, member 2B (RHOXF2B), mRNA.


RefSeq Accession Definition Services Price Order
NM_001099685 Homo sapiens Rhox homeobox family, member 2B (RHOXF2B), mRNA. ORF Sequence $251.43
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001099685.1, 153791493
Length 1309 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens Rhox homeobox family, member 2B (RHOXF2B), mRNA.
Product rhox homeobox family member 2B
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AC005023.1. On Jul 25, 2007 this sequence version replaced gi:113430056.


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.


##Evidence-Data-START## RNAseq introns :: single sample supports all introns ERS025084, ERS025085 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_001093155.1
CDS 191..1057
Misc Feature(1)113..115
Misc Feature(2)113..115
Misc Feature(3)611..769
Misc Feature(4)611..769
Misc Feature(5)order(611..613,662..664,680..682,719..721,725..730,
Misc Feature(6)order(728..730,737..742,749..751)
Misc Feature(7)746..775
Exon (1)1..269
Gene:RHOXF2B
Gene Synonym:RHOXF2B
Exon (2)270..681
Gene:RHOXF2B
Gene Synonym:RHOXF2B
Exon (3)682..727
Gene:RHOXF2B
Gene Synonym:RHOXF2B
Exon (4)728..1309
Gene:RHOXF2B
Gene Synonym:RHOXF2B
Translation MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKL KSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGNLEGTSGSDGNVEDSDQSEKEPGQQYSR PQGAVGGLEPGNAQQPNVHAFTPLQLQELECIFQREQFPSEFLRRRLARSMNVTELAVQI WFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSS SLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(440)-dbSNP:
complement(440)-t, cdbSNP:199654934
complement(491)-g, cdbSNP:202022237
complement(716)-dbSNP:
complement(716)-g, adbSNP:201815129
Gene SymbolRHOXF2B
Gene SynonymRHOXF2B
ChromosomeX
Locus MapXq24
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001099685 Homo sapiens Rhox homeobox family, member 2B (RHOXF2B), mRNA. Full Length $379.61
ORF Sequence $251.43
XM_003960835 PREDICTED: Homo sapiens Rhox homeobox family, member 2B (RHOXF2B), mRNA. Full Length $377.58
ORF Sequence $333.21

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878