Homo sapiens Rhox homeobox family, member 2B (RHOXF2B), mRNA.
| RefSeq Version | NM_001099685.1, 153791493 |
| Length | 1309 bp |
| Structure | linear |
| Update Date | 11-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens Rhox homeobox family, member 2B (RHOXF2B), mRNA. |
| Product | rhox homeobox family member 2B |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AC005023.1. On Jul 25, 2007 this sequence version replaced gi:113430056. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. |
| RefSeq | NP_001093155.1 |
| CDS | 191..1057 | Exon (1) | 1..269 | Exon (2) | 1..269 | Exon (3) | 270..681 | Exon (4) | 682..727 | Exon (5) | 728..1309 |
| Translation | MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKL
KSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGNLEGTSGSDGNVEDSDQSEKEPGQQYSR
PQGAVGGLEPGNAQQPNVHAFTPLQLQELECIFQREQFPSEFLRRRLARSMNVTELAVQI
WFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSS
SLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 9 | + | a, g | dbSNP:6646598 |
| complement(89) | - | t, c | dbSNP:3810752 |
| complement(146) | - | g, a | dbSNP:113051913 |
| 395 | + | a, g | dbSNP:62637695 |
| 457 | + | a, g | dbSNP:35263081 |
| complement(467) | - | t, c | dbSNP:40786 |
| 505 | + | a, g | dbSNP:76849625 |
| 641 | + | c, t | dbSNP:40785 |
| complement(716) | - | g, a | dbSNP:3764830 |
| 894 | + | a, g | dbSNP:6646602 |
| 1047 | + | c, t | dbSNP:35435371 |
| complement(1257..1258) | - | , c | dbSNP:35812130 |
| Gene Symbol | RHOXF2B |
| Gene Synonym | RHOXF2B |
| Chromosome | X |
| Locus Map | Xq24 |
| All Transcripts | NM_001099685 |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |