• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001099857 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_001099857.2, 544063455
Length 2279 bp
Structure linear
Update Date 26-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1, mRNA.
Product NF-kappa-B essential modulator isoform a
Comment

Summary: This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. Multiple transcript variants encoding different isoforms have been found for this gene. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (1) represents the longest transcript and encodes isoform a. Variants 1 and 3 encode the same isoform.

RefSeq NP_001093327.1
CDS 415..1674
Misc Feature(1)394..396
Misc Feature(2)505..507
Misc Feature(3)505..507
Misc Feature(4)541..543
Misc Feature(5)544..747
Misc Feature(6)544..747
Misc Feature(7)616..618
Misc Feature(8)667..669
Misc Feature(9)<742..>1092
Misc Feature(10)862..1185
Misc Feature(11)1138..1464
Misc Feature(12)1150..1509
Misc Feature(13)1165..1671
Misc Feature(14)1186..1446
Misc Feature(15)order(1189..1194,1201..1206,1210..1215,1222..1224,
Misc Feature(16)order(1300..1302,1312..1317,1321..1326,1333..1341,
Misc Feature(17)1378..1443
Misc Feature(18)1540..1542
Misc Feature(19)1558..1671
Misc Feature(20)1573..1575
Exon (1)1..399
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (2)400..601
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (3)602..813
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (4)814..932
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (5)933..1085
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (6)1086..1182
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (7)1183..1326
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (8)1327..1469
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (9)1470..1531
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (10)1532..2259
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Translation MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
224+dbSNP:
224+c, tdbSNP:111827785
420+c, tdbSNP:376019792
421+a, cdbSNP:57174646
552+c, tdbSNP:149511938
553+a, gdbSNP:143999678
565+c, tdbSNP:377406996
583+a, gdbSNP:148695964
598+c, tdbSNP:137853323
679..681+dbSNP:
679..681+, gagdbSNP:386134238
751+a, gdbSNP:179363896
781+c, tdbSNP:179363895
872+dbSNP:
872+g, tdbSNP:137853328
884+a, cdbSNP:386134240
931+c, gdbSNP:179363866
938+dbSNP:
938+c, gdbSNP:179363868
1094+dbSNP:
1094+c, tdbSNP:179363869
1277+dbSNP:
1277+c, gdbSNP:137853330
1345+dbSNP:
1345+a, gdbSNP:179363867
1358+a, cdbSNP:137853331
1370+a, gdbSNP:137853332
1381+c, gdbSNP:179363865
1585+dbSNP:
1585+g, tdbSNP:137853324
1621+c, tdbSNP:137853329
1631+a, tdbSNP:137853327
1633+a, gdbSNP:137853322
1663+c, tdbSNP:137853325
1664+a, g, tdbSNP:137853326
1673+a, gdbSNP:137853321
Gene SymbolIKBKG
Gene SynonymAMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
ChromosomeX
Locus MapXq28
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001099856 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 2, mRNA. On-demand $699.00 18
NM_001145255 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 4, mRNA. On-demand $549.00 14
NM_003639 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3, mRNA. On-demand $699.00 18
NM_001099857 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1, mRNA. On-demand $699.00 18
XM_005274760 PREDICTED: Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant X1, mRNA. On-demand $699.00 18
XM_006724853 PREDICTED: Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant X6, mRNA. On-demand $699.00 18
XM_005274761 PREDICTED: Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant X2, mRNA. On-demand $699.00 18
XM_005274763 PREDICTED: Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant X4, mRNA. On-demand $699.00 18
XM_005274764 PREDICTED: Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant X5, mRNA. On-demand $699.00 18
Title IkappaB kinase gamma/nuclear factor-kappaB-essential modulator (IKKgamma/NEMO) facilitates RhoA GTPase activation, which, in turn, activates Rho-associated KINASE (ROCK) to phosphorylate IKKbeta in response to transforming growth factor (TGF)-beta1 .
Author Kim HJ, Kim JG, Moon MY, Park SH and Park JB.
Journal J. Biol. Chem. 289 (3), 1429-1440 (2014)
Title Mutation of nonessential cysteines shows that the NF-kappaB essential modulator forms a constitutive noncovalent dimer that binds IkappaB kinase-beta with high affinity .
Author Cote SM, Gilmore TD, Shaffer R, Weber U, Bollam R, Golden MS, Glover K, Herscovitch M, Ennis T, Allen KN and Whitty A.
Journal Biochemistry 52 (51), 9141-9154 (2013)
Title USP10 inhibits genotoxic NF-kappaB activation by MCPIP1-facilitated deubiquitination of NEMO .
Author Niu J, Shi Y, Xue J, Miao R, Huang S, Wang T, Wu J, Fu M and Wu ZH.
Journal EMBO J. 32 (24), 3206-3219 (2013)
Title Merkel cell polyomavirus small T antigen targets the NEMO adaptor protein to disrupt inflammatory signaling .
Author Griffiths DA, Abdul-Sada H, Knight LM, Jackson BR, Richards K, Prescott EL, Peach AH, Blair GE, Macdonald A and Whitehouse A.
Journal J. Virol. 87 (24), 13853-13867 (2013)
Title Identification of a cell protein (FIP-3) as a modulator of NF-kappaB activity and as a target of an adenovirus inhibitor of tumor necrosis factor alpha-induced apoptosis .
Author Li Y, Kang J, Friedman J, Tarassishin L, Ye J, Kovalenko A, Wallach
Journal Proc. Natl. Acad. Sci. U.S.A. 96 (3), 1042-1047 (1999)
Title IkappaB kinase (IKK)-associated protein 1, a common component of the heterogeneous IKK complex .
Author Mercurio F, Murray BW, Shevchenko A, Bennett BL, Young DB, Li JW, Pascual G, Motiwala A, Zhu H, Mann M and Manning AM.
Journal Mol. Cell. Biol. 19 (2), 1526-1538 (1999)
Title IKK-gamma is an essential regulatory subunit of the IkappaB kinase complex .
Author Rothwarf DM, Zandi E, Natoli G and Karin M.
Journal Nature 395 (6699), 297-300 (1998)
Title Tumor necrosis factor receptor-associated factors (TRAFs)--a family of adapter proteins that regulates life and death .
Author Arch RH, Gedrich RW and Thompson CB.
Journal Genes Dev. 12 (18), 2821-2830 (1998)
Title Incontinentia Pigmenti .
Author Scheuerle,A. and Ursini,M.V.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Anophthalmia/Microphthalmia Overview .
Author Bardakjian,T., Weiss,A. and Schneider,A.S.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.