• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_001099857 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1, mRNA. ORF Sequence $365.40
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001099857.1, 153792132
Length 2279 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1, mRNA.
Product NF-kappa-B essential modulator isoform a
Comment

Summary: This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. Multiple transcript variants encoding different isoforms have been found for this gene. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longer isoform (a). Variants 1 and 3 both encode the same isoform (a).

RefSeq NP_001093327.1
CDS 415..1674
Misc Feature(1)394..396
Misc Feature(2)505..507
Misc Feature(3)505..507
Misc Feature(4)541..543
Misc Feature(5)544..747
Misc Feature(6)544..747
Misc Feature(7)616..618
Misc Feature(8)667..669
Misc Feature(9)862..1185
Misc Feature(10)1138..1464
Misc Feature(11)1150..1509
Misc Feature(12)1165..1671
Misc Feature(13)<1255..>1350
Misc Feature(14)order(1300..1302,1312..1317,1321..1326,1333..1341,
Misc Feature(15)1378..1443
Misc Feature(16)1540..1542
Misc Feature(17)1558..1671
Exon (1)1..399
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (2)400..601
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (3)602..813
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (4)814..932
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (5)933..1085
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (6)1086..1182
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (7)1183..1326
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (8)1327..1469
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (9)1470..1531
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (10)1532..2259
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Translation MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
224+dbSNP:
224+c, tdbSNP:111827785
421+a, cdbSNP:57174646
552+c, tdbSNP:149511938
553+a, gdbSNP:143999678
583+a, gdbSNP:148695964
598+c, tdbSNP:137853323
751+dbSNP:
751+a, gdbSNP:179363896
781+c, tdbSNP:179363895
872+dbSNP:
872+g, tdbSNP:137853328
931+c, gdbSNP:179363866
938+dbSNP:
938+c, gdbSNP:179363868
1094+dbSNP:
1094+c, tdbSNP:179363869
1277+dbSNP:
1277+c, gdbSNP:137853330
1345+dbSNP:
1345+a, gdbSNP:179363867
1358+a, cdbSNP:137853331
1370+a, gdbSNP:137853332
1381+c, gdbSNP:179363865
1585+dbSNP:
1585+g, tdbSNP:137853324
1621+c, tdbSNP:137853329
1631+a, tdbSNP:137853327
1633+a, gdbSNP:137853322
1663+c, tdbSNP:137853325
1664+a, g, tdbSNP:137853326
1673+a, gdbSNP:137853321
Gene SymbolIKBKG
Gene SynonymAMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
ChromosomeX
Locus MapXq28
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001099856 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 2, mRNA. Full Length $604.94
ORF Sequence $424.56
NM_001099857 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1, mRNA. Full Length $660.91
ORF Sequence $365.40
NM_001145255 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 4, mRNA. Full Length $574.78
ORF Sequence $279.27
NM_003639 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3, mRNA. Full Length $614.80
ORF Sequence $365.40
Title FIP3-endosome-dependent formation of the secondary ingression mediates ESCRT-III recruitment during cytokinesis .
Author Schiel,J.A., Simon,G.C., Zaharris,C., Weisz,J., Castle,D., Wu,C.C. and Prekeris,R.
Journal Nat. Cell Biol. 14 (10), 1068-1078 (2012)
Title Linear ubiquitination of NEMO negatively regulates the interferon antiviral response through disruption of the MAVS-TRAF3 complex .
Author Belgnaoui,S.M., Paz,S., Samuel,S., Goulet,M.L., Sun,Q., Kikkert,M., Iwai,K., Dikic,I., Hiscott,J. and Lin,R.
Journal Cell Host Microbe 12 (2), 211-222 (2012)
Title Novel Phosphorylations of IKKgamma/NEMO .
Author Lee,S.H., Toth,Z., Wong,L.Y., Brulois,K., Nguyen,J., Lee,J.Y., Zandi,E. and Jung,J.U.
Journal MBio 3 (6), E00411-E00412 (2012)
Title p47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO .
Author Shibata,Y., Oyama,M., Kozuka-Hata,H., Han,X., Tanaka,Y., Gohda,J. and Inoue,J.
Journal Nat Commun 3, 1061 (2012)
Title NEMO inhibits programmed necrosis in an NFkappaB-independent manner by restraining RIP1 .
Author O'Donnell,M.A., Hase,H., Legarda,D. and Ting,A.T.
Journal PLoS ONE 7 (7), E41238 (2012)
Title Isolation of full-length cDNA and chromosomal localization of human NF-kappaB modulator NEMO to Xq28 .
Author Jin,D.Y. and Jeang,K.T.
Journal J. Biomed. Sci. 6 (2), 115-120 (1999)
Title Identification of a cell protein (FIP-3) as a modulator of NF-kappaB activity and as a target of an adenovirus inhibitor of tumor necrosis factor alpha-induced apoptosis .
Author Li,Y., Kang,J., Friedman,J., Tarassishin,L., Ye,J., Kovalenko,A., Wallach,D. and Horwitz,M.S.
Journal Proc. Natl. Acad. Sci. U.S.A. 96 (3), 1042-1047 (1999)
Title IkappaB kinase (IKK)-associated protein 1, a common component of the heterogeneous IKK complex .
Author Mercurio,F., Murray,B.W., Shevchenko,A., Bennett,B.L., Young,D.B., Li,J.W., Pascual,G., Motiwala,A., Zhu,H., Mann,M. and Manning,A.M.
Journal Mol. Cell. Biol. 19 (2), 1526-1538 (1999)
Title IKK-gamma is an essential regulatory subunit of the IkappaB kinase complex .
Author Rothwarf,D.M., Zandi,E., Natoli,G. and Karin,M.
Journal Nature 395 (6699), 297-300 (1998)
Title Tumor necrosis factor receptor-associated factors (TRAFs)--a family of adapter proteins that regulates life and death .
Author Arch,R.H., Gedrich,R.W. and Thompson,C.B.
Journal Genes Dev. 12 (18), 2821-2830 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878