• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu37216 Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $4749.00 40
OHu37216C Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 1, mRNA. Customized vector On-demand $4749.00 40

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001099952.2, 269954689
Length 8133 bp
Structure linear
Update Date 14-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 1, mRNA.
Product inositol 1,4,5-trisphosphate receptor type 1 isoform 1
Comment

Summary: This gene encodes an intracellular receptor for inositol 1,4,5-trisphosphate. Upon stimulation by inositol 1,4,5-trisphosphate, this receptor mediates calcium release from the endoplasmic reticulum. Mutations in this gene cause spinocerebellar ataxia type 15, a disease associated with an heterogeneous group of cerebellar disorders. Multiple transcript variants have been identified for this gene. [provided by RefSeq, Nov 2009].


Transcript Variant: This variant (1) encodes isoform 1.

RefSeq NP_001093422.2
CDS 351..8483
Misc Feature(1)10
Misc Feature(2)10
Misc Feature(3)204..206
Misc Feature(4)360..1025
Misc Feature(5)360..1025
Misc Feature(6)1041..1211
Misc Feature(7)1044..1649
Misc Feature(8)1143..1157
Misc Feature(9)1230..>1313
Misc Feature(10)1764..2381
Misc Feature(11)1872..1883
Misc Feature(12)2049..2057
Misc Feature(13)3876..4415
Misc Feature(14)5115..5117
Misc Feature(15)5496..5498
Misc Feature(16)6117..6455
Misc Feature(17)7047..>7619
Misc Feature(18)7053..7115
Misc Feature(19)7149..7211
Misc Feature(20)7290..7352
Misc Feature(21)7308..7997
Misc Feature(22)7422..7484
Misc Feature(23)7551..7613
Misc Feature(24)7620..7817
Misc Feature(25)7938..8000
Exon (1)1..258
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (2)259..334
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (3)335..442
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (4)443..513
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (5)514..629
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (6)630..716
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (7)717..875
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (8)876..974
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (9)975..1058
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (10)1059..1205
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (11)1206..1301
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (12)1302..1346
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (13)1347..1501
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (14)1502..1601
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (15)1602..1762
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (16)1763..1904
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (17)1905..2063
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (18)2064..2236
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (19)2237..2356
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (20)2357..2554
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (21)2555..2806
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (22)2807..2948
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (23)2949..3102
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (24)3103..3290
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (25)3291..3429
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (26)3430..3484
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (27)3485..3650
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (28)3651..3821
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (29)3822..3887
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (30)3888..4025
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (31)4026..4151
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (32)4152..4352
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (33)4353..4604
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (34)4605..4730
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (35)4731..4859
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (36)4860..4980
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (37)4981..5165
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (38)5166..5314
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (39)5315..5426
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (40)5427..5559
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (41)5560..5750
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (42)5751..5931
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (43)5932..6185
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (44)6186..6386
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (45)6387..6497
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (46)6498..6593
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (47)6594..6716
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (48)6717..6821
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (49)6822..7014
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (50)7015..7137
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (51)7138..7313
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (52)7314..7478
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (53)7479..7674
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (54)7675..7767
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (55)7768..7907
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (56)7908..8073
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (57)8074..8234
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (58)8235..8396
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Exon (59)8397..10098
Gene:ITPR1
Gene Synonym:ACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Translation MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT NADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH VTTIFPISKMAKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAE PEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQE GPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGA LQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGP DETMDGASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRK QQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHI NLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAE GKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVE LLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKE IYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQST TLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVN NLFLKSHSIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQ AELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLR EMMTKDRGYGEKGEALRQVLVNRYYGNVRPSGRRESLTSFGNGPLSAGGPGKPGGGGGGS GSSSMSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQ HSFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKK AKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMS AVITIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGL LGLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKK RMDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGE NGEDGAASPRNVGHNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAKHTAQIEIVR LDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKL RAQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLIS LAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFT RGYRAMVLDVEFLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRS IILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVE SGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEE PLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDK FDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRA MSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPP HMNVNPQQPA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
32+c, tdbSNP:185002607
90+a, gdbSNP:189889792
97+c, gdbSNP:183196616
169+c, gdbSNP:41276527
270+dbSNP:
270+a, gdbSNP:13319720
349+dbSNP:
349+a, gdbSNP:369723935
404+c, tdbSNP:373630095
407+a, gdbSNP:200534989
416+a, gdbSNP:112944532
491+dbSNP:
491+c, tdbSNP:370939479
528+dbSNP:
528+c, gdbSNP:376974334
538+c, tdbSNP:370953766
586+g, tdbSNP:374495990
605+c, tdbSNP:367814655
629+c, tdbSNP:371299264
639+dbSNP:
639+a, gdbSNP:189931297
653+a, gdbSNP:374450149
706+a, gdbSNP:367863297
788+dbSNP:
788+c, tdbSNP:61741506
807+a, gdbSNP:377211856
865+c, tdbSNP:146177759
882+dbSNP:
882+a, gdbSNP:188477537
908+c, tdbSNP:377387496
909+a, gdbSNP:370705612
995+dbSNP:
995+c, tdbSNP:372005596
997+c, tdbSNP:373911976
1064+dbSNP:
1064+c, tdbSNP:368692477
1139+c, tdbSNP:369681244
1163+a, gdbSNP:112057923
1214+dbSNP:
1214+g, tdbSNP:372668740
1227+c, tdbSNP:377049416
1232+c, tdbSNP:370157764
1252+c, gdbSNP:374940696
1279+c, tdbSNP:201693219
1280+a, gdbSNP:28565126
1283+a, gdbSNP:374618053
1372+dbSNP:
1372+a, gdbSNP:373174492
1383+a, cdbSNP:369055445
1384+a, gdbSNP:201804963
1385+a, gdbSNP:375108490
complement(1475)-t, g, cdbSNP:2306869
1484+c, tdbSNP:374022504
1489+g, tdbSNP:6766212
1541+dbSNP:
1541+c, gdbSNP:370559048
1649..1650+dbSNP:
1649..1650+, cdbSNP:35237427
1652+a, gdbSNP:34252981
1690+a, gdbSNP:147337859
1724+a, gdbSNP:370781648
1730+a, gdbSNP:375697840
1757+a, gdbSNP:368530106
1799+dbSNP:
1799+c, tdbSNP:192247062
1830+a, gdbSNP:41289628
1867+a, gdbSNP:368765538
1886+a, gdbSNP:35047189
1900+a, gdbSNP:376503958
1940+dbSNP:
1940+c, tdbSNP:371013311
complement(2112)-dbSNP:
complement(2112)-t, gdbSNP:79933397
2123+g, tdbSNP:191028530
2154+a, gdbSNP:397514536
2216+c, gdbSNP:371291291
2217+a, cdbSNP:374124279
2265+dbSNP:
2265+a, gdbSNP:376189314
2276+c, tdbSNP:61757106
2294+c, tdbSNP:372037170
2301+c, tdbSNP:375234629
2333+c, tdbSNP:369495242
2357+dbSNP:
2357+a, gdbSNP:2306875
2378+a, gdbSNP:377194292
2446..2447+, g, ggdbSNP:149971162
2448+g, tdbSNP:80238585
2457+a, gdbSNP:185464679
2461+c, gdbSNP:373694009
2537+c, tdbSNP:376805768
2538+a, gdbSNP:370701686
2576+dbSNP:
2576+a, gdbSNP:41289636
2597+a, gdbSNP:368492569
2615+a, cdbSNP:372382966
2630+g, tdbSNP:375801584
2649+c, tdbSNP:377248442
2655+a, gdbSNP:35789999
2655+a, gdbSNP:386488599
2663+c, tdbSNP:371705815
2681+a, cdbSNP:371819405
2684+c, tdbSNP:36103112
2753+c, tdbSNP:140248948
2754+a, gdbSNP:369080877
2783+a, tdbSNP:145220403
2789+a, gdbSNP:35946460
2804+c, tdbSNP:369671510
2805+a, gdbSNP:200199463
2966+dbSNP:
2966+a, gdbSNP:375533002
3008+a, cdbSNP:2306877
3017+c, tdbSNP:372384335
3036+c, tdbSNP:111670385
3050+c, tdbSNP:372877080
3074+c, gdbSNP:376692603
3077+a, gdbSNP:187516662
3082+c, tdbSNP:201519806
3111+dbSNP:
3111+a, gdbSNP:369458550
3131+c, tdbSNP:373515668
3177+c, tdbSNP:377497261
3252+a, gdbSNP:370220353
3304+dbSNP:
3304+a, tdbSNP:368367629
3380+a, gdbSNP:200705345
3381+c, gdbSNP:11721218
3530+dbSNP:
3530+c, tdbSNP:186541002
3571+c, tdbSNP:121912425
3657+dbSNP:
3657+c, tdbSNP:375889786
3730..3731+, gdbSNP:34654476
3768+c, gdbSNP:369999170
3770+c, tdbSNP:372672483
3780+a, gdbSNP:199698357
3783+g, tdbSNP:377443898
3784+a, gdbSNP:61751570
3784+c, tdbSNP:386492913
3830+dbSNP:
3830+a, tdbSNP:199876574
3833+a, cdbSNP:201072463
3838+c, gdbSNP:375025757
3924+dbSNP:
3924+a, gdbSNP:367882836
3980+c, tdbSNP:201621621
3981+a, gdbSNP:376380738
3983+a, gdbSNP:199960483
3987+a, gdbSNP:372881053
3992+a, gdbSNP:201263269
4024+a, gdbSNP:79902620
4028+dbSNP:
4028+c, tdbSNP:34635052
4079+a, gdbSNP:369352810
4088+c, tdbSNP:140402012
4125+a, cdbSNP:191197622
4159+dbSNP:
4159+a, cdbSNP:199577774
4212+a, gdbSNP:61757107
4217+c, tdbSNP:182840163
4239+a, gdbSNP:187604016
4244+c, tdbSNP:61757108
4268+c, tdbSNP:193212750
4296+a, gdbSNP:368659431
4338+a, gdbSNP:372380638
4379+dbSNP:
4379+c, tdbSNP:371697661
4428+c, gdbSNP:61757109
4478+c, tdbSNP:267599850
4487+c, tdbSNP:375770679
4556+a, gdbSNP:373572745
4569+a, gdbSNP:373436949
4574+c, tdbSNP:375223250
4577+g, tdbSNP:142527379
4586+c, gdbSNP:61757110
4611+dbSNP:
4611+a, gdbSNP:3749383
4613+g, tdbSNP:370995278
4744+dbSNP:
4744+c, tdbSNP:188558398
4768+c, tdbSNP:199530586
4784+c, tdbSNP:375804162
4785+a, gdbSNP:367817220
4790+c, tdbSNP:371385393
4796+c, tdbSNP:192863290
4797+a, gdbSNP:200646875
4825+a, gdbSNP:373200660
4849+c, tdbSNP:370021605
4895+dbSNP:
4895+c, tdbSNP:200605212
4898+g, tdbSNP:368481395
4946+c, tdbSNP:34748547
5007+dbSNP:
5007+a, gdbSNP:397514535
5042+c, gdbSNP:375679048
5067..5068+, aacdbSNP:369905100
5067+a, cdbSNP:200618740
5082+c, tdbSNP:368516308
5102+c, tdbSNP:371821418
5106+c, tdbSNP:373619512
5144+a, gdbSNP:116819405
5160+c, tdbSNP:367643585
5177+dbSNP:
5177+c, tdbSNP:373127487
5178+a, gdbSNP:377441762
5273+a, tdbSNP:368759221
5300..5301+, gggg, ggggggdbSNP:146079808
5302..5303+, gggtgtttdbSNP:140264007
5367+dbSNP:
5367+a, cdbSNP:374156463
5375+a, cdbSNP:377535170
5406+a, gdbSNP:371186107
5411+a, gdbSNP:375480720
5471+dbSNP:
5471+c, tdbSNP:61757111
5473+c, tdbSNP:377243043
5483+a, gdbSNP:368425885
complement(5488)-t, cdbSNP:2291864
5488+a, gdbSNP:386563940
5509+g, tdbSNP:371697516
5518+c, gdbSNP:376656471
5541+a, gdbSNP:369108656
5543+a, cdbSNP:372981054
5560+dbSNP:
5560+g, tdbSNP:200004069
5571+a, gdbSNP:373359869
5603+g, tdbSNP:376278816
5647+a, gdbSNP:200927261
5672+c, tdbSNP:113368815
5744+c, tdbSNP:140165655
5767+dbSNP:
5767+a, gdbSNP:375517463
5778+a, gdbSNP:368582066
5827+g, tdbSNP:143093165
5876+g, tdbSNP:377225391
5894+c, tdbSNP:367889492
5895+a, gdbSNP:370615766
5897+c, tdbSNP:371661663
5943+dbSNP:
5943+a, cdbSNP:71313897
5968+a, gdbSNP:375223667
5972+c, tdbSNP:201311531
5991+a, gdbSNP:377199612
6005+a, gdbSNP:369478428
6006+a, gdbSNP:373554736
6041+c, tdbSNP:201949292
6095+c, tdbSNP:377489220
6111+a, gdbSNP:369005032
6275+dbSNP:
6275+c, tdbSNP:374602663
6317+c, tdbSNP:6442905
6323+a, gdbSNP:139528715
6353+c, tdbSNP:144178989
6417+dbSNP:
6417+a, gdbSNP:367644690
6434+a, cdbSNP:201421463
6554+dbSNP:
6554+c, tdbSNP:182891619
6555+g, tdbSNP:373973399
6614+dbSNP:
6614+c, gdbSNP:35469408
6646+c, gdbSNP:371303646
6653+c, tdbSNP:202123078
6654+a, gdbSNP:199890939
6667+c, tdbSNP:372040946
6671+a, gdbSNP:376367207
6674+c, tdbSNP:369524054
6785+dbSNP:
6785+a, cdbSNP:35343277
6809+a, gdbSNP:149339933
complement(6834)-dbSNP:
complement(6834)-g, cdbSNP:139244792
6902+a, gdbSNP:34491089
6921+a, gdbSNP:372814462
6923+a, gdbSNP:13079522
6932+c, tdbSNP:114359276
7022+dbSNP:
7022+c, tdbSNP:139021152
7044+a, cdbSNP:368097378
7070+a, gdbSNP:370852124
7082+c, tdbSNP:373926844
7106+a, gdbSNP:368681501
7118+a, gdbSNP:200426774
7122+a, cdbSNP:61757112
7159+dbSNP:
7159+c, tdbSNP:373459293
7179+a, tdbSNP:375240191
7199+c, tdbSNP:369778265
complement(7260)-g, adbSNP:2291862
7304+c, tdbSNP:41290672
7305+a, gdbSNP:201144431
7400+dbSNP:
7400+c, tdbSNP:370200529
7427+g, tdbSNP:374773506
7536+dbSNP:
7536+c, tdbSNP:112560414
7587+c, tdbSNP:375563105
7595+c, tdbSNP:200487406
7600+g, tdbSNP:372892598
7680+dbSNP:
7680+a, gdbSNP:187571979
7682+c, tdbSNP:369181276
7697+c, tdbSNP:371986594
7712+c, tdbSNP:375227391
7713+a, gdbSNP:369481606
7715+c, tdbSNP:79720149
7719+c, tdbSNP:376337317
7765+a, gdbSNP:369183965
7789+dbSNP:
7789+c, tdbSNP:373614009
7800+a, gdbSNP:367632214
7820+a, gdbSNP:146028585
7836+a, gdbSNP:371726673
7841+c, tdbSNP:711631
7847+g, tdbSNP:369547064
7851+c, gdbSNP:371809744
7865+c, tdbSNP:200562410
7895+a, gdbSNP:901854
7925+dbSNP:
7925+a, tdbSNP:375507523
7943+c, tdbSNP:148734757
8042+a, gdbSNP:377529395
8075+dbSNP:
8075+a, cdbSNP:367926649
8081+a, gdbSNP:113496930
8165+c, tdbSNP:371988852
8186+c, tdbSNP:375633303
8192+c, tdbSNP:368405302
8198+c, tdbSNP:201894676
8216+c, tdbSNP:372433483
8360+dbSNP:
8360+a, gdbSNP:368813104
8372+a, cdbSNP:73098087
8445+dbSNP:
8445+c, tdbSNP:201306619
8454+a, gdbSNP:201934670
8483+a, gdbSNP:376816678
8494+g, tdbSNP:371142544
8530..8531+cg, gtdbSNP:386657790
8530+c, gdbSNP:74998763
8531+g, tdbSNP:77764633
8552+a, cdbSNP:374393849
8562+a, cdbSNP:185314417
8564+c, tdbSNP:187833245
8604+c, gdbSNP:146903558
8607+g, tdbSNP:368212698
8742+a, cdbSNP:192961109
8839..8840+, tgdbSNP:113825412
8876+c, gdbSNP:184284696
8940+g, tdbSNP:188232131
9003+a, cdbSNP:3207963
9126+a, tdbSNP:41305987
9134+c, tdbSNP:181050042
9200..9201+, aattdbSNP:76766340
9250..9251+, gdbSNP:35018130
9260+c, tdbSNP:41315884
9294..9295+, caatdbSNP:148070806
9330+a, gdbSNP:41304181
9332+a, gdbSNP:374200769
9380+c, tdbSNP:184906116
9425+g, tdbSNP:41308218
9454+a, gdbSNP:190654621
complement(9462)-t, adbSNP:147782346
complement(9491)-g, adbSNP:141084091
9532+c, tdbSNP:181501860
9639+a, cdbSNP:73099961
9652+a, gdbSNP:201254573
9653..9654+, aa, aaadbSNP:36064013
9653+a, cdbSNP:202059633
9654..9655+, aadbSNP:71779262
9654+, adbSNP:199685819
9667..9668+, aa, aaadbSNP:3079679
9667..9668+, aa, aaadbSNP:386355726
9681+c, tdbSNP:367636150
9696..9697+, gdbSNP:34968946
9849+a, c, tdbSNP:146958900
9868+a, gdbSNP:9875113
9970+c, tdbSNP:187032288
9974+c, tdbSNP:191698945
10014+a, g, tdbSNP:9817206
10016+a, gdbSNP:377290142
10045..10046+, tctdbSNP:374862384
10093+c, tdbSNP:181237786
Gene SymbolITPR1
Gene SynonymACV; CLA4; INSP3R1; IP3R; IP3R1; PPP1R94; SCA15; SCA16; SCA29
Chromosome3
Locus Map3p26.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002222 Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 2, mRNA. On-demand $4749.00 40
NM_001099952 Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 1, mRNA. On-demand $4749.00 40
NM_001168272 Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 3, mRNA. On-demand $4749.00 40
XM_006713131 PREDICTED: Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant X4, mRNA. On-demand $4749.00 40
XM_005265109 PREDICTED: Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant X2, mRNA. On-demand $4749.00 40
XM_006713132 PREDICTED: Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant X5, mRNA. On-demand $4749.00 40
XM_006713133 PREDICTED: Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant X6, mRNA. On-demand $4749.00 40
XM_005265110 PREDICTED: Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant X3, mRNA. On-demand $4749.00 40
XM_006713134 PREDICTED: Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant X7, mRNA. On-demand $4749.00 40
XM_006713135 PREDICTED: Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant X8, mRNA. On-demand $4749.00 40
XM_006713136 PREDICTED: Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant X9, mRNA. On-demand $4749.00 40
Title Nuclear ALG-2 protein interacts with Ca2+ homeostasis endoplasmic reticulum protein (CHERP) Ca2+-dependently and participates in regulation of alternative splicing of inositol trisphosphate receptor type 1 (IP3R1) pre-mRNA .
Author Sasaki-Osugi K, Imoto C, Takahara T, Shibata H and Maki M.
Journal J. Biol. Chem. 288 (46), 33361-33375 (2013)
Title Functional inositol 1,4,5-trisphosphate receptors assembled from concatenated homo- and heteromeric subunits .
Author Alzayady KJ, Wagner LE 2nd, Chandrasekhar R, Monteagudo A, Godiska R, Tall GG, Joseph SK and Yule DI.
Journal J. Biol. Chem. 288 (41), 29772-29784 (2013)
Title Inositol 1, 4, 5-trisphosphate receptors and human left ventricular myocytes .
Author Signore S, Sorrentino A, Ferreira-Martins J, Kannappan R, Shafaie M, Del Ben F, Isobe K, Arranto C, Wybieralska E, Webster A, Sanada F, Ogorek B, Zheng H, Liu X, Del Monte F, D'Alessandro DA, Wunimenghe O, Michler RE, Hosoda T, Goichberg P, Leri A, Kajstura J, Anversa P and Rota M.
Journal Circulation 128 (12), 1286-1297 (2013)
Title Sulphide signalling potentiates apoptosis through the up-regulation of IP3 receptor types 1 and 2 .
Author Lencesova L, Hudecova S, Csaderova L, Markova J, Soltysova A, Pastorek M, Sedlak J, Wood ME, Whiteman M, Ondrias K and Krizanova O.
Journal Acta Physiol (Oxf) 208 (4), 350-361 (2013)
Title Cloning and characterization of the type I inositol 1,4,5-trisphosphate receptor gene promoter. Regulation by 17beta-estradiol in osteoblasts .
Author Kirkwood KL, Homick K, Dragon MB and Bradford PG.
Journal J. Biol. Chem. 272 (36), 22425-22431 (1997)
Title Heteroligomers of type-I and type-III inositol trisphosphate receptors in WB rat liver epithelial cells .
Author Joseph SK, Lin C, Pierson S, Thomas AP and Maranto AR.
Journal J. Biol. Chem. 270 (40), 23310-23316 (1995)
Title Molecular cloning of a cDNA for the human inositol 1,4,5-trisphosphate receptor type 1, and the identification of a third alternatively spliced variant .
Author Nucifora FC Jr, Li SH, Danoff S, Ullrich A and Ross CA.
Journal Brain Res. Mol. Brain Res. 32 (2), 291-296 (1995)
Title Spinocerebellar Ataxia Type 15 .
Author Storey,E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Hereditary Ataxia Overview .
Author Bird,T.D.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Receptor-activated single channels in intact human platelets .
Author Mahaut-Smith MP, Sage SO and Rink TJ.
Journal J. Biol. Chem. 265 (18), 10479-10483 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.