• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001099952 Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $4749.00 40

*Business Day

Related Services

RefSeq Version NM_001099952.2, 269954689
Length 10098 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 1, mRNA.
Product inositol 1,4,5-trisphosphate receptor type 1 isoform 1
Comment

Summary: This gene encodes an intracellular receptor for inositol 1,4,5-trisphosphate. Upon stimulation by inositol 1,4,5-trisphosphate, this receptor mediates calcium release from the endoplasmic reticulum. Mutations in this gene cause spinocerebellar ataxia type 15, a disease associated with an heterogeneous group of cerebellar disorders. Multiple transcript variants have been identified for this gene. [provided by RefSeq, Nov 2009].


Transcript Variant: This variant (1) encodes isoform 1.

RefSeq NP_001093422.2
CDS 351..8483
Misc Feature(1)10
Misc Feature(2)10
Misc Feature(3)204..206
Misc Feature(4)360..1025
Misc Feature(5)360..1025
Misc Feature(6)684..848
Misc Feature(7)867..1010
Misc Feature(8)1041..1211
Misc Feature(9)1044..1649
Misc Feature(10)1143..1157
Misc Feature(11)1230..>1313
Misc Feature(12)1764..2381
Misc Feature(13)1872..1883
Misc Feature(14)2049..2057
Misc Feature(15)3876..4415
Misc Feature(16)5115..5117
Misc Feature(17)5496..5498
Misc Feature(18)6117..6455
Misc Feature(19)7053..7115
Misc Feature(20)7149..7211
Misc Feature(21)7290..7352
Misc Feature(22)7308..7997
Misc Feature(23)7422..7484
Misc Feature(24)7551..7613
Misc Feature(25)7620..7817
Misc Feature(26)7938..8000
Exon (1)1..258
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (2)259..334
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (3)335..442
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (4)443..513
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (5)514..629
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (6)630..716
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (7)717..875
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (8)876..974
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (9)975..1058
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (10)1059..1205
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (11)1206..1301
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (12)1302..1346
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (13)1347..1501
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (14)1502..1601
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (15)1602..1762
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (16)1763..1904
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (17)1905..2063
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (18)2064..2236
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (19)2237..2356
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (20)2357..2554
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (21)2555..2806
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (22)2807..2948
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (23)2949..3102
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (24)3103..3290
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (25)3291..3429
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (26)3430..3484
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (27)3485..3650
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (28)3651..3821
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (29)3822..3887
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (30)3888..4025
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (31)4026..4151
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (32)4152..4352
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (33)4353..4604
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (34)4605..4730
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (35)4731..4859
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (36)4860..4980
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (37)4981..5165
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (38)5166..5314
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (39)5315..5426
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (40)5427..5559
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (41)5560..5750
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (42)5751..5931
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (43)5932..6185
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (44)6186..6386
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (45)6387..6497
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (46)6498..6593
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (47)6594..6716
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (48)6717..6821
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (49)6822..7014
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (50)7015..7137
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (51)7138..7313
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (52)7314..7478
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (53)7479..7674
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (54)7675..7767
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (55)7768..7907
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (56)7908..8073
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (57)8074..8234
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (58)8235..8396
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Exon (59)8397..10098
Gene:ITPR1
Gene Synonym:INSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Translation MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT NADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH VTTIFPISKMAKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAE PEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQE GPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGA LQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGP DETMDGASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRK QQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHI NLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAE GKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVE LLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKE IYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQST TLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVN NLFLKSHSIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQ AELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLR EMMTKDRGYGEKGEALRQVLVNRYYGNVRPSGRRESLTSFGNGPLSAGGPGKPGGGGGGS GSSSMSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQ HSFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKK AKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMS AVITIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGL LGLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKK RMDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGE NGEDGAASPRNVGHNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAKHTAQIEIVR LDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKL RAQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLIS LAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFT RGYRAMVLDVEFLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRS IILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVE SGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEE PLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDK FDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRA MSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPP HMNVNPQQPA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
32+c, tdbSNP:185002607
90+a, gdbSNP:189889792
97+c, gdbSNP:183196616
169+c, gdbSNP:41276527
270+dbSNP:
270+a, gdbSNP:13319720
407+a, gdbSNP:200534989
416+a, gdbSNP:112944532
639+dbSNP:
639+a, gdbSNP:189931297
788+dbSNP:
788+c, tdbSNP:61741506
865+c, tdbSNP:146177759
882+dbSNP:
882+a, gdbSNP:188477537
1163+dbSNP:
1163+a, gdbSNP:112057923
1279+dbSNP:
1279+c, tdbSNP:201693219
1280+a, gdbSNP:28565126
1384+dbSNP:
1384+a, gdbSNP:201804963
1475+c, g, tdbSNP:2306869
1489+g, tdbSNP:6766212
1649..1650+dbSNP:
1649..1650+, cdbSNP:35237427
1652+a, gdbSNP:34252981
1690+a, gdbSNP:147337859
1799+dbSNP:
1799+c, tdbSNP:192247062
1830+a, gdbSNP:41289628
1886+a, gdbSNP:35047189
2112+dbSNP:
2112+g, tdbSNP:79933397
2123+g, tdbSNP:191028530
2276+dbSNP:
2276+c, tdbSNP:61757106
2357+dbSNP:
2357+a, gdbSNP:2306875
2446..2447+, gdbSNP:149971162
2448+g, tdbSNP:80238585
2457+a, gdbSNP:185464679
2576+dbSNP:
2576+a, gdbSNP:41289636
2655+a, gdbSNP:35789999
2684+c, tdbSNP:36103112
2753+c, tdbSNP:140248948
2783+a, tdbSNP:145220403
2789+a, gdbSNP:35946460
2805+a, gdbSNP:200199463
3008+dbSNP:
3008+a, cdbSNP:2306877
3036+c, tdbSNP:111670385
3077+a, gdbSNP:187516662
3082+c, tdbSNP:201519806
3380+dbSNP:
3380+a, gdbSNP:200705345
3381+c, gdbSNP:11721218
3530+dbSNP:
3530+c, tdbSNP:186541002
3571+c, tdbSNP:121912425
3729..3730+dbSNP:
3729..3730+, gdbSNP:34654476
3780+a, gdbSNP:199698357
3784+a, gdbSNP:61751570
3830+dbSNP:
3830+a, tdbSNP:199876574
3833+a, cdbSNP:201072463
3980+dbSNP:
3980+c, tdbSNP:201621621
3983+a, gdbSNP:199960483
3992+a, gdbSNP:201263269
4024+a, gdbSNP:79902620
4028+dbSNP:
4028+c, tdbSNP:34635052
4088+c, tdbSNP:140402012
4125+a, cdbSNP:191197622
4159+dbSNP:
4159+a, cdbSNP:199577774
4212+a, gdbSNP:61757107
4217+c, tdbSNP:182840163
4239+a, gdbSNP:187604016
4244+c, tdbSNP:61757108
4268+c, tdbSNP:193212750
4428+dbSNP:
4428+c, gdbSNP:61757109
4577+g, tdbSNP:142527379
4586+c, gdbSNP:61757110
4611+dbSNP:
4611+a, gdbSNP:3749383
4744+dbSNP:
4744+c, tdbSNP:188558398
4768+c, tdbSNP:199530586
4796+c, tdbSNP:192863290
4797+a, gdbSNP:200646875
4895+dbSNP:
4895+c, tdbSNP:200605212
4946+c, tdbSNP:34748547
5067+dbSNP:
5067+a, cdbSNP:200618740
5144+a, gdbSNP:116819405
5300..5301+dbSNP:
5300..5301+, gggg, ggggggdbSNP:146079808
5302..5303+, gggtgtttdbSNP:140264007
5471+dbSNP:
5471+c, tdbSNP:61757111
5488+c, tdbSNP:2291864
5560+dbSNP:
5560+g, tdbSNP:200004069
5647+a, gdbSNP:200927261
5672+c, tdbSNP:113368815
5744+c, tdbSNP:140165655
5827+dbSNP:
5827+g, tdbSNP:143093165
5943+dbSNP:
5943+a, cdbSNP:71313897
5972+c, tdbSNP:201311531
6041+c, tdbSNP:201949292
6317+dbSNP:
6317+c, tdbSNP:6442905
6323+a, gdbSNP:139528715
6353+c, tdbSNP:144178989
6434+a, cdbSNP:201421463
6554+dbSNP:
6554+c, tdbSNP:182891619
6614+dbSNP:
6614+c, gdbSNP:35469408
6653+c, tdbSNP:202123078
6654+a, gdbSNP:199890939
6785+dbSNP:
6785+a, cdbSNP:35343277
6809+a, gdbSNP:149339933
6834+dbSNP:
6834+c, gdbSNP:139244792
6902+a, gdbSNP:34491089
6923+a, gdbSNP:13079522
6932+c, tdbSNP:114359276
7022+dbSNP:
7022+c, tdbSNP:139021152
7118+a, gdbSNP:200426774
7122+a, cdbSNP:61757112
7260+dbSNP:
7260+a, gdbSNP:2291862
7304+c, tdbSNP:41290672
7305+a, gdbSNP:201144431
7536+dbSNP:
7536+c, tdbSNP:112560414
7595+c, tdbSNP:200487406
7680+dbSNP:
7680+a, gdbSNP:187571979
7715+c, tdbSNP:79720149
7820+dbSNP:
7820+a, gdbSNP:146028585
7841+c, tdbSNP:711631
7865+c, tdbSNP:200562410
7895+a, gdbSNP:901854
7943+dbSNP:
7943+c, tdbSNP:148734757
8081+dbSNP:
8081+a, gdbSNP:113496930
8198+c, tdbSNP:201894676
8372+dbSNP:
8372+a, cdbSNP:73098087
8445+dbSNP:
8445+c, tdbSNP:201306619
8454+a, gdbSNP:201934670
8530+c, gdbSNP:74998763
8531+g, tdbSNP:77764633
8562+a, cdbSNP:185314417
8564+c, tdbSNP:187833245
8604+c, gdbSNP:146903558
8742+a, cdbSNP:192961109
8839..8840+, tgdbSNP:113825412
8876+c, gdbSNP:184284696
8940+g, tdbSNP:188232131
9003+a, cdbSNP:3207963
9126+a, tdbSNP:41305987
9134+c, tdbSNP:181050042
9200..9201+, aattdbSNP:76766340
9250..9251+, gdbSNP:35018130
9260+c, tdbSNP:41315884
9294..9295+, caatdbSNP:148070806
9330+a, gdbSNP:41304181
9380+c, tdbSNP:184906116
9425+g, tdbSNP:41308218
9454+a, gdbSNP:190654621
9462+a, tdbSNP:147782346
9491+a, gdbSNP:141084091
9532+c, tdbSNP:181501860
9639+a, cdbSNP:73099961
9652+a, gdbSNP:201254573
9653..9654+, aadbSNP:36064013
9653+a, cdbSNP:202059633
9654..9655+, aadbSNP:71779262
9654+, adbSNP:199685819
9658..9659+, a, aadbSNP:67490215
9667..9668+, aa, aaadbSNP:3079679
9696..9697+, gdbSNP:34968946
9849+c, tdbSNP:146958900
9868+a, gdbSNP:9875113
9970+c, tdbSNP:187032288
9974+c, tdbSNP:191698945
10014+a, g, tdbSNP:9817206
10093+c, tdbSNP:181237786
Gene SymbolITPR1
Gene SynonymINSP3R1; IP3R; IP3R1; SCA15; SCA16; SCA29
Chromosome3
Locus Map3p26.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001099952 Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 1, mRNA. On-demand $4749.00 40
NM_001168272 Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 3, mRNA. On-demand $4749.00 40
NM_002222 Homo sapiens inositol 1,4,5-trisphosphate receptor, type 1 (ITPR1), transcript variant 2, mRNA. On-demand $4749.00 40
Title High-content RNAi screening identifies the Type 1 inositol triphosphate receptor as a modifier of TDP-43 localization and neurotoxicity .
Author Kim,S.H., Zhan,L., Hanson,K.A. and Tibbetts,R.S.
Journal Hum. Mol. Genet. 21 (22), 4845-4856 (2012)
Title Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction .
Author Wilk,J.B., Shrine,N.R., Loehr,L.R., Zhao,J.H., Manichaikul,A., Lopez,L.M., Smith,A.V., Heckbert,S.R., Smolonska,J., Tang,W., Loth,D.W., Curjuric,I., Hui,J., Cho,M.H., Latourelle,J.C., Henry,A.P., Aldrich,M., Bakke,P., Beaty,T.H., Bentley,A.R., Borecki,I.B., Brusselle,G.G., Burkart,K.M., Chen,T.H., Couper,D., Crapo,J.D., Davies,G., Dupuis,J., Franceschini,N., Gulsvik,A., Hancock,D.B., Harris,T.B., Hofman,A., Imboden,M., James,A.L., Khaw,K.T., Lahousse,L., Launer,L.J., Litonjua,A., Liu,Y., Lohman,K.K., Lomas,D.A., Lumley,T., Marciante,K.D., McArdle,W.L., Meibohm,B., Morrison,A.C., Musk,A.W., Myers,R.H., North,K.E., Postma,D.S., Psaty,B.M., Rich,S.S., Rivadeneira,F., Rochat,T., Rotter,J.I., Artigas,M.S., Starr,J.M., Uitterlinden,A.G., Wareham,N.J., Wijmenga,C., Zanen,P., Province,M.A., Silverman,E.K., Deary,I.J., Palmer,L.J., Cassano,P.A., Gudnason,V., Barr,R.G., Loos,R.J., Strachan,D.P., London,S.J., Boezen,H.M., Probst-Hensch,N., Gharib,S.A., Hall,I.P., O'Connor,G.T., Tobin,M.D. and Stricker,B.H.
Journal Am. J. Respir. Crit. Care Med. 186 (7), 622-632 (2012)
Title The anti-aggregation effects of ondansetron on platelets involve IP3 signaling and MAP kinase pathway, but not 5-HT3-dependent pathway .
Author Liu,F.C., Liou,J.T., Liao,H.R., Mao,C.C., Yang,P. and Day,Y.J.
Journal Thromb. Res. 130 (3), E84-E94 (2012)
Title Type 1 inositol-1,4,5-trisphosphate receptor is a late substrate of caspases during apoptosis .
Author Elkoreh,G., Blais,V., Beliveau,E., Guillemette,G. and Denault,J.B.
Journal J. Cell. Biochem. 113 (8), 2775-2784 (2012)
Title Prevalence of inositol 1, 4, 5-triphosphate receptor type 1 gene deletion, the mutation for spinocerebellar ataxia type 15, in Japan screened by gene dosage .
Author Obayashi,M., Ishikawa,K., Izumi,Y., Takahashi,M., Niimi,Y., Sato,N., Onodera,O., Kaji,R., Nishizawa,M. and Mizusawa,H.
Journal J. Hum. Genet. 57 (3), 202-206 (2012)
Title Cloning and characterization of the type I inositol 1,4,5-trisphosphate receptor gene promoter. Regulation by 17beta-estradiol in osteoblasts .
Author Kirkwood,K.L., Homick,K., Dragon,M.B. and Bradford,P.G.
Journal J. Biol. Chem. 272 (36), 22425-22431 (1997)
Title Heteroligomers of type-I and type-III inositol trisphosphate receptors in WB rat liver epithelial cells .
Author Joseph,S.K., Lin,C., Pierson,S., Thomas,A.P. and Maranto,A.R.
Journal J. Biol. Chem. 270 (40), 23310-23316 (1995)
Title Molecular cloning of a cDNA for the human inositol 1,4,5-trisphosphate receptor type 1, and the identification of a third alternatively spliced variant .
Author Nucifora,F.C. Jr., Li,S.H., Danoff,S., Ullrich,A. and Ross,C.A.
Journal Brain Res. Mol. Brain Res. 32 (2), 291-296 (1995)
Title The human type 1 inositol 1,4,5-trisphosphate receptor from T lymphocytes. Structure, localization, and tyrosine phosphorylation .
Author Harnick,D.J., Jayaraman,T., Ma,Y., Mulieri,P., Go,L.O. and Marks,A.R.
Journal J. Biol. Chem. 270 (6), 2833-2840 (1995)
Title Receptor-activated single channels in intact human platelets .
Author Mahaut-Smith,M.P., Sage,S.O. and Rink,T.J.
Journal J. Biol. Chem. 265 (18), 10479-10483 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.