• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 3 (XRCC3), transcript variant 3, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25309 Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 3 (XRCC3), transcript variant 3, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu25309C Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 3 (XRCC3), transcript variant 3, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001100118.1, 153946426
Length 1041 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 3 (XRCC3), transcript variant 3, mRNA.
Product DNA repair protein XRCC3
Comment

Summary: This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene functionally complements Chinese hamster irs1SF, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents and is chromosomally unstable. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (3) lacks a segment in the 5' UTR, compared to variant 1. Variants 1, 2 and 3 encode the same protein.

RefSeq NP_001093588.1
CDS 324..1364
Misc Feature(1)240..242
Misc Feature(2)240..242
Misc Feature(3)324..326
Misc Feature(4)324..326
Misc Feature(5)327..1334
Misc Feature(6)567..1337
Misc Feature(7)642..665
Misc Feature(8)order(648..650,660..665,738..740,744..746,750..752,
Misc Feature(9)order(735..737,741..743,765..767,774..776,831..833,
Misc Feature(10)948..962
Exon (1)1..63
Gene:XRCC3
Gene Synonym:CMM6
Exon (2)64..165
Gene:XRCC3
Gene Synonym:CMM6
Exon (3)166..378
Gene:XRCC3
Gene Synonym:CMM6
Exon (4)379..516
Gene:XRCC3
Gene Synonym:CMM6
Exon (5)517..729
Gene:XRCC3
Gene Synonym:CMM6
Exon (6)730..884
Gene:XRCC3
Gene Synonym:CMM6
Exon (7)885..1097
Gene:XRCC3
Gene Synonym:CMM6
Exon (8)1098..1144
Gene:XRCC3
Gene Synonym:CMM6
Exon (9)1145..2545
Gene:XRCC3
Gene Synonym:CMM6
Translation MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGS SILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQL CLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIF IEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGA TLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADR LREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(158)-dbSNP:
complement(158)-g, adbSNP:199632866
complement(278)-t, adbSNP:373800330
complement(288)-g, cdbSNP:370388004
complement(299)-t, adbSNP:56018633
complement(318)-t, cdbSNP:376582164
complement(338)-t, cdbSNP:56377012
complement(455)-dbSNP:
complement(455)-t, cdbSNP:3212045
complement(455)-t, cdbSNP:386580871
complement(478)-g, adbSNP:117761689
complement(489)-t, gdbSNP:372985882
complement(490)-t, cdbSNP:369879767
complement(495)-g, adbSNP:143410843
complement(496)-t, cdbSNP:139963722
complement(544)-dbSNP:
complement(544)-t, cdbSNP:372383657
complement(569)-t, cdbSNP:370617343
complement(584)-t, cdbSNP:374354789
604+a, gdbSNP:3212057
complement(641)-g, adbSNP:368062647
complement(644)-t, cdbSNP:374120119
complement(674)-t, cdbSNP:371455247
complement(705)-g, adbSNP:377685108
complement(730)-dbSNP:
complement(730)-g, cdbSNP:200124946
complement(735)-t, cdbSNP:146507354
complement(746)-g, adbSNP:200567298
complement(748)-g, adbSNP:201561134
complement(755)-g, adbSNP:374168537
complement(756)-t, cdbSNP:149963487
complement(764)-t, cdbSNP:138987760
complement(771)-g, adbSNP:150729160
complement(777)-g, adbSNP:141201371
complement(799)-g, adbSNP:199681385
complement(801)-g, adbSNP:56347206
complement(805)-g, adbSNP:369021228
complement(811)-g, cdbSNP:376618856
815+c, tdbSNP:28903079
complement(816)-t, cdbSNP:143171186
complement(843)-g, adbSNP:56288529
complement(866)-g, adbSNP:373040437
complement(878)-g, adbSNP:200230392
complement(899)-dbSNP:
complement(899)-t, cdbSNP:146875659
complement(919)-g, adbSNP:372108006
complement(920)-g, adbSNP:200213277
complement(959)-g, adbSNP:41285494
complement(960)-t, cdbSNP:149642280
complement(965)-t, cdbSNP:200948313
complement(985)-t, cdbSNP:201886982
complement(989)-t, adbSNP:368831796
complement(999)-g, cdbSNP:373720646
complement(1001)-t, cdbSNP:376831498
complement(1034)-g, adbSNP:138142727
complement(1040)-t, cdbSNP:188768970
1045+c, tdbSNP:861539
complement(1046)-c, adbSNP:79874791
complement(1051)-t, cdbSNP:77381814
complement(1079)-g, adbSNP:200657624
complement(1088)-g, adbSNP:373638417
complement(1110)-dbSNP:
complement(1110)-t, cdbSNP:145063633
complement(1134)-t, cdbSNP:386576408
complement(1134)-g, adbSNP:28903080
complement(1150)-dbSNP:
complement(1150)-t, cdbSNP:140979846
complement(1169)-t, cdbSNP:370905714
complement(1179)-t, cdbSNP:368289157
complement(1222)-t, c, adbSNP:187038000
1228+a, gdbSNP:28903081
complement(1229)-g, adbSNP:370391238
complement(1236)-t, cdbSNP:267603888
complement(1315)-g, adbSNP:200382220
complement(1332)-, cdbSNP:34183054
complement(1351)-g, adbSNP:377185194
complement(1387)-g, adbSNP:372513712
complement(1405)-t, cdbSNP:370272845
complement(1411)-g, adbSNP:376407692
complement(1488)-t, cdbSNP:55748757
1509+c, tdbSNP:3212116
complement(1637)-t, cdbSNP:189909594
complement(1812)-c, adbSNP:3212117
complement(1826)-g, adbSNP:34023186
complement(1865)-t, cdbSNP:3212118
complement(1866)-t, cdbSNP:144660634
complement(1884..1885)-, cdbSNP:34231836
1896+a, gdbSNP:3212119
complement(1903)-t, cdbSNP:77103957
complement(1929)-t, gdbSNP:140813869
complement(1949)-g, adbSNP:3212120
complement(1965)-t, cdbSNP:118143436
complement(1977)-g, adbSNP:3212121
2118+c, tdbSNP:11546527
2147+c, tdbSNP:3212122
2152+c, tdbSNP:3212123
complement(2171)-t, cdbSNP:3212124
complement(2172)-t, cdbSNP:117875015
2219+c, tdbSNP:11546528
2232+g, tdbSNP:3212125
complement(2271..2300)-, cagtgtgggactgcaggacagggtcctgcadbSNP:377198655
complement(2276..2305)-, ctgcacagtgtgggactgcaggacagggtcdbSNP:150768508
complement(2319)-g, cdbSNP:186232444
complement(2414)-t, cdbSNP:78863423
complement(2414)-g, adbSNP:386449172
complement(2424..2425)-, gdbSNP:34975865
2458+a, gdbSNP:3212126
complement(2478)-g, cdbSNP:75104408
2481+a, tdbSNP:45625536
Gene SymbolXRCC3
Gene SynonymCMM6
Chromosome14
Locus Map14q32.3
Title Neonatal genome-wide methylation patterns in relation to birth weight in the Norwegian Mother and Child Cohort .
Author Engel,S.M., Joubert,B.R., Wu,M.C., Olshan,A.F., Haberg,S.E., Ueland,P.M., Nystad,W., Nilsen,R.M., Vollset,S.E., Peddada,S.D. and London,S.J.
Journal Am. J. Epidemiol. 179 (7), 834-842 (2014)
Title XRCC3 polymorphisms are associated with the risk of developing radiation-induced late xerostomia in nasopharyngeal carcinoma patients treated with intensity modulation radiated therapy .
Author Zou Y, Song T, Yu W, Zhao R, Wang Y, Xie R, Chen T, Wu B and Wu S.
Journal Jpn. J. Clin. Oncol. 44 (3), 241-248 (2014)
Title Quantitative assessment of the associations between DNA repair gene XRCC3 Thr241Met polymorphism and gastric cancer .
Author Wang Z, Chen X, Liu B, Li S, Liu M and Xue H.
Journal Tumour Biol. 35 (2), 1589-1598 (2014)
Title The Thr241Met polymorphism in the XRCC3 gene is associated with increased risk of cancer in Chinese mainland populations .
Author Du L, Xiong T, He Q, Wang Y, Shen J, Peng Y, Jia Q, Yang J, Zhang Y and Huang J.
Journal Tumour Biol. 35 (2), 1371-1376 (2014)
Title Quantitative assessment of the association between XRCC3 C18607T polymorphism and glioma risk .
Author Wang R, Li M, Gao WW, Gu Y, Guo Y, Wang G and Tian HL.
Journal Tumour Biol. 35 (2), 1101-1105 (2014)
Title The XRCC2 and XRCC3 repair genes are required for chromosome stability in mammalian cells .
Author Cui X, Brenneman M, Meyne J, Oshimura M, Goodwin EH and Chen DJ.
Journal Mutat. Res. 434 (2), 75-88 (1999)
Title XRCC2 and XRCC3, new human Rad51-family members, promote chromosome stability and protect against DNA cross-links and other damages .
Author Liu N, Lamerdin JE, Tebbs RS, Schild D, Tucker JD, Shen MR, Brookman KW, Siciliano MJ, Walter CA, Fan W, Narayana LS, Zhou ZQ, Adamson AW, Sorensen KJ, Chen DJ, Jones NJ and Thompson LH.
Journal Mol. Cell 1 (6), 783-793 (1998)
Title Rare microsatellite polymorphisms in the DNA repair genes XRCC1, XRCC3 and XRCC5 associated with cancer in patients of varying radiosensitivity .
Author Price EA, Bourne SL, Radbourne R, Lawton PA, Lamerdin J, Thompson
Journal Somat. Cell Mol. Genet. 23 (4), 237-247 (1997)
Title Correction of chromosomal instability and sensitivity to diverse mutagens by a cloned cDNA of the XRCC3 DNA repair gene .
Author Tebbs RS, Zhao Y, Tucker JD, Scheerer JB, Siciliano MJ, Hwang M, Liu N, Legerski RJ and Thompson LH.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (14), 6354-6358 (1995)
Title [Rational approaches to the treatment of urinary incontinence (author's transl)] .
Author Kopecny,J.
Journal Cesk Gynekol 41 (6), 408-409 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.