• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 3 (XRCC3), transcript variant 3, mRNA.


RefSeq Accession Definition Services Price Order
NM_001100118 Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 3 (XRCC3), transcript variant 3, mRNA. ORF Sequence $301.89
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001100118.1, 153946426
Length 2563 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 3 (XRCC3), transcript variant 3, mRNA.
Product DNA repair protein XRCC3
Comment

Summary: This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene functionally complements Chinese hamster irs1SF, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents and is chromosomally unstable. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (3) lacks a segment in the 5' UTR, compared to variant 1. Variants 1, 2 and 3 encode the same protein.

RefSeq NP_001093588.1
CDS 324..1364
Misc Feature(1)240..242
Misc Feature(2)240..242
Misc Feature(3)390..1334
Misc Feature(4)390..1334
Misc Feature(5)567..1337
Misc Feature(6)642..665
Misc Feature(7)order(648..650,660..665,738..740,744..746,750..752,
Misc Feature(8)order(735..737,741..743,765..767,774..776,831..833,
Misc Feature(9)948..962
Exon (1)1..63
Gene:XRCC3
Gene Synonym:CMM6
Exon (2)64..165
Gene:XRCC3
Gene Synonym:CMM6
Exon (3)166..378
Gene:XRCC3
Gene Synonym:CMM6
Exon (4)379..516
Gene:XRCC3
Gene Synonym:CMM6
Exon (5)517..729
Gene:XRCC3
Gene Synonym:CMM6
Exon (6)730..884
Gene:XRCC3
Gene Synonym:CMM6
Exon (7)885..1097
Gene:XRCC3
Gene Synonym:CMM6
Exon (8)1098..1144
Gene:XRCC3
Gene Synonym:CMM6
Exon (9)1145..2545
Gene:XRCC3
Gene Synonym:CMM6
Translation MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGS SILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQL CLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIF IEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGA TLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADR LREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(158)-dbSNP:
complement(158)-g, adbSNP:199632866
complement(299)-t, adbSNP:56018633
complement(338)-t, cdbSNP:56377012
complement(455)-dbSNP:
complement(455)-t, cdbSNP:3212045
complement(478)-g, adbSNP:117761689
complement(479)-t, cdbSNP:146725448
complement(495)-g, adbSNP:143410843
complement(496)-t, cdbSNP:139963722
complement(604)-dbSNP:
complement(604)-g, adbSNP:3212057
complement(730)-dbSNP:
complement(730)-g, cdbSNP:200124946
complement(735)-t, cdbSNP:146507354
complement(746)-g, adbSNP:200567298
complement(748)-g, adbSNP:201561134
complement(756)-t, cdbSNP:149963487
complement(764)-t, cdbSNP:138987760
complement(771)-g, adbSNP:150729160
complement(777)-g, adbSNP:141201371
complement(799)-g, adbSNP:199681385
complement(801)-g, adbSNP:56347206
complement(815)-t, cdbSNP:28903079
complement(816)-t, cdbSNP:143171186
complement(843)-g, adbSNP:56288529
complement(878)-g, adbSNP:200230392
complement(899)-dbSNP:
complement(899)-t, cdbSNP:146875659
complement(920)-g, adbSNP:200213277
complement(959)-g, adbSNP:41285494
complement(960)-t, cdbSNP:149642280
complement(965)-t, cdbSNP:200948313
complement(985)-t, cdbSNP:201886982
complement(1034)-g, adbSNP:138142727
complement(1040)-t, cdbSNP:188768970
complement(1045)-t, cdbSNP:861539
complement(1046)-c, adbSNP:79874791
complement(1051)-t, cdbSNP:77381814
complement(1079)-g, adbSNP:200657624
complement(1110)-dbSNP:
complement(1110)-t, cdbSNP:145063633
complement(1134)-g, adbSNP:28903080
complement(1150)-dbSNP:
complement(1150)-t, cdbSNP:140979846
complement(1222)-c, adbSNP:187038000
complement(1228)-g, adbSNP:28903081
complement(1315)-g, adbSNP:200382220
complement(1332)-, cdbSNP:34183054
complement(1488)-t, cdbSNP:55748757
complement(1509)-t, cdbSNP:3212116
complement(1637)-t, cdbSNP:189909594
complement(1812)-c, adbSNP:3212117
complement(1826)-g, adbSNP:34023186
complement(1865)-t, cdbSNP:3212118
complement(1866)-t, cdbSNP:144660634
complement(1884..1885)-, cdbSNP:34231836
complement(1896)-g, adbSNP:3212119
complement(1903)-t, cdbSNP:77103957
complement(1929)-t, gdbSNP:140813869
complement(1949)-g, adbSNP:3212120
complement(1965)-t, cdbSNP:118143436
complement(1977)-g, adbSNP:3212121
complement(2118)-t, cdbSNP:11546527
complement(2147)-t, cdbSNP:3212122
complement(2152)-t, cdbSNP:3212123
complement(2171)-t, cdbSNP:3212124
complement(2172)-t, cdbSNP:117875015
complement(2219)-t, cdbSNP:11546528
complement(2232)-t, gdbSNP:3212125
complement(2276..2305)-, ctgcacagtgtgggactgcaggacagggtcdbSNP:150768508
complement(2276)-, ctgcacagtgtgggactgcaggacagggtcdbSNP:55903728
complement(2319)-g, cdbSNP:186232444
complement(2414)-t, cdbSNP:78863423
complement(2424..2425)-, gdbSNP:34975865
complement(2458)-g, adbSNP:3212126
complement(2478)-g, cdbSNP:75104408
complement(2481)-t, adbSNP:45625536
Gene SymbolXRCC3
Gene SynonymCMM6
Chromosome14
Locus Map14q32.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001100118 Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 3 (XRCC3), transcript variant 3, mRNA. Full Length $743.27
ORF Sequence $301.89
NM_001100119 Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 3 (XRCC3), transcript variant 1, mRNA. Full Length $770.53
ORF Sequence $301.89
NM_005432 Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 3 (XRCC3), transcript variant 2, mRNA. Full Length $759.80
ORF Sequence $301.89
Title DNA repair polymorphisms influence the risk of second neoplasm after treatment of childhood acute lymphoblastic leukemia .
Author Erculj,N., Faganel Kotnik,B., Debeljak,M., Jazbec,J. and Dolzan,V.
Journal J. Cancer Res. Clin. Oncol. 138 (11), 1919-1930 (2012)
Title An interethnic variability and a functional prediction of DNA repair gene polymorphisms: the example of XRCC3 (p.Thr241>Met) and .
Author Ben Salah,G., Fendri-Kriaa,N., Kamoun,H., Kallabi,F., Mkaouar-Rebai,E., Fourati,A., Ayadi,H. and Fakhfakh,F.
Journal Mol. Biol. Rep. 39 (10), 9639-9647 (2012)
Title Genetic variability of Xrcc3 and Rad51 modulates the risk of head and neck cancer .
Author Gresner,P., Gromadzinska,J., Polanska,K., Twardowska,E., Jurewicz,J. and Wasowicz,W.
Journal Gene 504 (2), 166-174 (2012)
Title Single nucleotide polymorphism (SNP) Thr241Met in the XRCC3 gene and breast cancer risk in Polish women .
Author Romanowicz-Makowska,H., Brys,M., Forma,E., Maciejczyk,R., Polac,I., Samulak,D., Michalska,M. and Smolarz,B.
Journal Pol J Pathol 63 (2), 121-125 (2012)
Title The association between polymorphisms of the RAD51-G135C, XRCC2-Arg188His and XRCC3-Thr241Met genes and clinico-pathologic features in breast cancer in Poland .
Author Romanowicz-Makowska,H., Smolarz,B., Zadrozny,M., Westfa,B., Baszczynski,J., Kokolaszwili,G., Burzyfiski,M., Polac,I. and Sporny,S.
Journal Eur. J. Gynaecol. Oncol. 33 (2), 145-150 (2012)
Title The XRCC2 and XRCC3 repair genes are required for chromosome stability in mammalian cells .
Author Cui,X., Brenneman,M., Meyne,J., Oshimura,M., Goodwin,E.H. and Chen,D.J.
Journal Mutat. Res. 434 (2), 75-88 (1999)
Title XRCC2 and XRCC3, new human Rad51-family members, promote chromosome stability and protect against DNA cross-links and other damages .
Author Liu,N., Lamerdin,J.E., Tebbs,R.S., Schild,D., Tucker,J.D., Shen,M.R., Brookman,K.W., Siciliano,M.J., Walter,C.A., Fan,W., Narayana,L.S., Zhou,Z.Q., Adamson,A.W., Sorensen,K.J., Chen,D.J., Jones,N.J. and Thompson,L.H.
Journal Mol. Cell 1 (6), 783-793 (1998)
Title Rare microsatellite polymorphisms in the DNA repair genes XRCC1, XRCC3 and XRCC5 associated with cancer in patients of varying radiosensitivity .
Author Price,E.A., Bourne,S.L., Radbourne,R., Lawton,P.A., Lamerdin,J., Thompson,L.H. and Arrand,J.E.
Journal Somat. Cell Mol. Genet. 23 (4), 237-247 (1997)
Title Correction of chromosomal instability and sensitivity to diverse mutagens by a cloned cDNA of the XRCC3 DNA repair gene .
Author Tebbs,R.S., Zhao,Y., Tucker,J.D., Scheerer,J.B., Siciliano,M.J., Hwang,M., Liu,N., Legerski,R.J. and Thompson,L.H.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (14), 6354-6358 (1995)
Title [Rational approaches to the treatment of urinary incontinence (author's transl)] .
Author Kopecny,J.
Journal Cesk Gynekol 41 (6), 408-409 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878