• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu26954 Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu26954C Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001109809.2, 239582721
Length 1611 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA.
Product zinc finger protein 57 homolog
Comment

Summary: The protein encoded by this gene is a zinc finger protein containing a KRAB domain. Studies in mouse suggest that this protein may function as a transcriptional repressor. Mutations in this gene have been associated with transient neonatal diabetes mellitus type 1 (TNDM1).[provided by RefSeq, Sep 2009].

RefSeq NP_001103279.2
CDS 152..1762
Misc Feature(1)281..397
Misc Feature(2)281..397
Misc Feature(3)<704..1441
Misc Feature(4)<737..982
Exon (1)1..274
Gene:ZFP57
Gene Synonym:bA145L22; bA145L22.2; C6orf40; TNDM1; ZNF698
Exon (2)275..401
Gene:ZFP57
Gene Synonym:bA145L22; bA145L22.2; C6orf40; TNDM1; ZNF698
Exon (3)402..503
Gene:ZFP57
Gene Synonym:bA145L22; bA145L22.2; C6orf40; TNDM1; ZNF698
Exon (4)504..1870
Gene:ZFP57
Gene Synonym:bA145L22; bA145L22.2; C6orf40; TNDM1; ZNF698
Translation MFEQLKPIEPVQKTLPWVGEVAATLQEAMKRDCWREARVKKKPVTFEDVAVNFTQEEWDC LDASQRVLYQDVMSETFKNLTSVARIFLHKPELITKLEQEEEQWREFVHLPNTEGLSEGK KKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPFFCYTC GKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTY CDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGT QAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAP ITGTLCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKS FSSFSRLVRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILG QWLGFSHDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTKEAVSILKHK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(62)-dbSNP:
complement(62)-t, cdbSNP:56225127
complement(207)-t, cdbSNP:371500990
complement(256)-t, cdbSNP:139717984
complement(263)-g, adbSNP:114772002
complement(264)-t, cdbSNP:142917604
complement(280)-dbSNP:
complement(280)-t, gdbSNP:374295115
complement(283)-t, gdbSNP:371178364
complement(307)-c, adbSNP:377042735
complement(334)-t, cdbSNP:375456558
complement(360)-t, adbSNP:191653089
complement(372)-g, c, adbSNP:186800938
complement(424)-dbSNP:
complement(424)-t, cdbSNP:373052417
complement(428)-g, cdbSNP:369213004
complement(433)-t, gdbSNP:377556293
complement(436)-g, adbSNP:373253380
complement(440)-t, gdbSNP:369717350
complement(525)-dbSNP:
complement(525)-t, cdbSNP:114591600
complement(538)-g, adbSNP:374760825
complement(626)-t, adbSNP:201703858
complement(642)-t, cdbSNP:200541066
complement(683)-g, adbSNP:146835830
complement(710)-g, adbSNP:61730330
complement(723)-t, cdbSNP:368581073
complement(730)-g, adbSNP:374182967
complement(731)-g, adbSNP:371536651
complement(744)-t, cdbSNP:9461544
complement(744)-g, adbSNP:386443489
complement(753)-t, adbSNP:375036402
complement(770)-g, cdbSNP:370274313
complement(852)-g, adbSNP:181230141
874+a, tdbSNP:387906227
complement(883)-g, adbSNP:190197921
894+a, gdbSNP:77625743
complement(900)-t, cdbSNP:199589695
complement(934)-t, g, adbSNP:61730328
980+a, cdbSNP:78378398
complement(994)-g, adbSNP:141297510
complement(1003)-t, cdbSNP:267600939
complement(1022)-g, cdbSNP:200369502
complement(1060)-t, cdbSNP:369847099
complement(1088)-t, cdbSNP:61730327
complement(1096)-t, gdbSNP:61730329
complement(1142)-t, cdbSNP:368879630
complement(1184)-g, cdbSNP:200537697
complement(1237)-g, adbSNP:61730326
complement(1252)-g, cdbSNP:202183128
1254+a, tdbSNP:2535241
complement(1260)-g, cdbSNP:185359504
complement(1269)-g, cdbSNP:193232883
complement(1310)-g, adbSNP:144633545
1365+c, gdbSNP:2535242
complement(1463)-t, cdbSNP:371992141
complement(1483)-g, adbSNP:59871039
1523+c, gdbSNP:79020217
complement(1531)-t, cdbSNP:368647820
complement(1577)-g, adbSNP:190525528
complement(1623)-g, cdbSNP:184974475
complement(1671)-t, cdbSNP:147411133
complement(1755)-t, cdbSNP:79455213
complement(1792)-g, adbSNP:200574995
1817+a, gdbSNP:149736421
Gene SymbolZFP57
Gene SynonymbA145L22; bA145L22.2; C6orf40; TNDM1; ZNF698
Chromosome6
Locus Map6p22.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001109809 Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. On-demand $219.00 7-9
NM_001109809 Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. On-demand $219.00 7-9
NM_001109809 Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. On-demand $219.00 7-9
NM_001109809 Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. On-demand $219.00 7-9
NM_001109809 Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. On-demand $219.00 7-9
NM_001109809 Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. On-demand $219.00 7-9
NM_001109809 Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. On-demand $219.00 7-9
NM_001109809 Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. On-demand $219.00 7-9
NM_001109809 Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. On-demand $219.00 7-9
NM_001109809 Homo sapiens ZFP57 zinc finger protein (ZFP57), mRNA. On-demand $219.00 7-9
Title Human and mouse ZFP57 proteins are functionally interchangeable in maintaining genomic imprinting at multiple imprinted regions in mouse ES cells .
Author Takikawa S, Wang X, Ray C, Vakulenko M, Bell FT and Li X.
Journal Epigenetics 8 (12), 1268-1279 (2013)
Title Genetic and epigenetic mutations affect the DNA binding capability of human ZFP57 in transient neonatal diabetes type 1 .
Author Baglivo I, Esposito S, De Cesare L, Sparago A, Anvar Z, Riso V, Cammisa M, Fattorusso R, Grimaldi G, Riccio A and Pedone PV.
Journal FEBS Lett. 587 (10), 1474-1481 (2013)
Title Transient neonatal diabetes mellitus in a Turkish patient with three novel homozygous variants in the ZFP57 gene .
Author Boyraz M, Ulucan K, Taskin N, Akcay T, Flanagan SE and Mackay DJ.
Journal J Clin Res Pediatr Endocrinol 5 (2), 125-128 (2013)
Title No evidence for pathogenic variants or maternal effect of ZFP57 as the cause of Beckwith-Wiedemann Syndrome .
Author Boonen SE, Hahnemann JM, Mackay D, Tommerup N, Brondum-Nielsen K, Tumer Z and Gronskov K.
Journal Eur. J. Hum. Genet. 20 (1), 119-121 (2012)
Title High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions .
Author Barcellos LF, May SL, Ramsay PP, Quach HL, Lane JA, Nititham J, Noble JA, Taylor KE, Quach DL, Chung SA, Kelly JA, Moser KL, Behrens TW, Seldin MF, Thomson G, Harley JB, Gaffney PM and Criswell LA.
Journal PLoS Genet. 5 (10), E1000696 (2009)
Title A maternal-zygotic effect gene, Zfp57, maintains both maternal and paternal imprints .
Author Li X, Ito M, Zhou F, Youngson N, Zuo X, Leder P and Ferguson-Smith AC.
Journal Dev. Cell 15 (4), 547-557 (2008)
Title Hypomethylation of multiple imprinted loci in individuals with transient neonatal diabetes is associated with mutations in ZFP57 .
Author Mackay DJ, Callaway JL, Marks SM, White HE, Acerini CL, Boonen SE, Dayanikli P, Firth HV, Goodship JA, Haemers AP, Hahnemann JM, Kordonouri O, Masoud AF, Oestergaard E, Storr J, Ellard S, Hattersley AT, Robinson DO and Temple IK.
Journal Nat. Genet. 40 (8), 949-951 (2008)
Title Identification and characterization of ZFP-57, a novel zinc finger transcription factor in the mammalian peripheral nervous system .
Author Alonso MB, Zoidl G, Taveggia C, Bosse F, Zoidl C, Rahman M, Parmantier E, Dean CH, Harris BS, Wrabetz L, Muller HW, Jessen KR and Mirsky R.
Journal J. Biol. Chem. 279 (24), 25653-25664 (2004)
Title A novel nuclear protein with zinc fingers down-regulated during early mammalian cell differentiation .
Author Okazaki S, Tanase S, Choudhury BK, Setoyama K, Miura R, Ogawa M and Setoyama C.
Journal J. Biol. Chem. 269 (9), 6900-6907 (1994)
Title Diabetes Mellitus, 6q24-Related Transient Neonatal .
Author Temple,I.K., Mackay,D.J.G. and Docherty,L.E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.