Homo sapiens zona pellucida glycoprotein 3 (sperm receptor) (ZP3), transcript variant 1, mRNA.
| RefSeq Version | NM_001110354.1, 160358849 |
| Length | 1317 bp |
| Structure | linear |
| Update Date | 12-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens zona pellucida glycoprotein 3 (sperm receptor) (ZP3), transcript variant 1, mRNA. |
| Product | zona pellucida sperm-binding protein 3 isoform 1 precursor |
| Comment | Summary: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longer isoform (1). |
| RefSeq | NP_001103824.1 |
| CDS | 11..1285 | Exon (1) | 1..322 | Exon (2) | 1..322 | Exon (3) | 323..441 | Exon (4) | 442..545 | Exon (5) | 546..723 | Exon (6) | 724..841 | Exon (7) | 842..933 | Exon (8) | 934..1070 | Exon (9) | 1071..1300 |
| Translation | MELSYRLFICLLLWGSTELCYPQPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLF
GTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDP
RPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEEN
WNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCL
VDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKAC
SFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADV
TVGPLIFLDRRGDHEVEQWALPSDTSVVLLGVGLAVVVSLTLTAVILVLTRRCRTASHPV
SASE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 9 | + | c, t | dbSNP:111488442 |
| complement(101) | - | t, c | dbSNP:2286428 |
| 118 | + | c, g | dbSNP:117869702 |
| 133 | + | c, t | dbSNP:114691990 |
| 196 | + | c, t | dbSNP:115350845 |
| 349 | + | a, c | dbSNP:114907010 |
| 557 | + | a, g | dbSNP:74676082 |
| 733 | + | c, t | dbSNP:112208102 |
| complement(778) | - | g, a | dbSNP:112837943 |
| complement(809) | - | g, c | dbSNP:17851474 |
| 904 | + | a, g | dbSNP:73363163 |
| complement(904) | - | t, c | dbSNP:79425252 |
| complement(953) | - | g, a | dbSNP:2906999 |
| complement(1023) | - | t, c | dbSNP:2906998 |
| 1023 | + | a, g | dbSNP:1065538 |
| complement(1028) | - | t, c | dbSNP:2906997 |
| 1044 | + | c, g | dbSNP:1804905 |
| 1092 | + | c, t | dbSNP:4109777 |
| complement(1095..1096) | - | , c | dbSNP:3215870 |
| complement(1123) | - | c, a | dbSNP:711306 |
| complement(1124) | - | c, a | dbSNP:17856528 |
| 1140 | + | a, g | dbSNP:71539279 |
| 1187 | + | c, g | dbSNP:4109778 |
| Gene Symbol | ZP3 |
| Gene Synonym | Zp-3; ZP3A; ZP3B; ZPC |
| Chromosome | 7 |
| Locus Map | 7q11.23 |
| All Transcripts | NM_001110354 , NM_007155 |
| Title | New genetic associations detected in a host response study to hepatitis B vaccine . |
| Author | Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M. |
| Journal | Genes Immun. 11 (3), 232-238 (2010) |
| Title | Identification of human sperm proteins that interact with human zona pellucida3 (ZP3) using yeast two-hybrid system . |
| Author | Naz,R.K. and Dhandapani,L. |
| Journal | J. Reprod. Immunol. 84 (1), 24-31 (2010) |
| Title | Functional activity of human ZP3 primary sperm receptor resides toward its C-terminus . |
| Author | Bansal,P., Chakrabarti,K. and Gupta,S.K. |
| Journal | Biol. Reprod. 81 (1), 7-15 (2009) |
| Title | DNA vaccine encoding chimeric protein encompassing epitopes of human ZP3 and ZP4: immunogenicity and characterization of antibodies . |
| Author | Choudhury,S., Ganguly,A., Chakrabarti,K., Sharma,R.K. and Gupta,S.K. |
| Journal | J. Reprod. Immunol. 79 (2), 137-147 (2009) |
| Title | Effects of native human zona pellucida glycoproteins 3 and 4 on acrosome reaction and zona pellucida binding of human spermatozoa . |
| Author | Chiu,P.C., Wong,B.S., Chung,M.K., Lam,K.K., Pang,R.T., Lee,K.F., Sumitro,S.B., Gupta,S.K. and Yeung,W.S. |
| Journal | Biol. Reprod. 79 (5), 869-877 (2008) |
| Title | POM-ZP3, a bipartite transcript derived from human ZP3 and a POM121 homologue . |
| Author | Kipersztok,S., Osawa,G.A., Liang,L.F., Modi,W.S. and Dean,J. |
| Journal | Genomics 25 (2), 354-359 (1995) |
| Title | Sperm require beta-N-acetylglucosaminidase to penetrate through the egg zona pellucida . |
| Author | Miller,D.J., Gong,X. and Shur,B.D. |
| Journal | Development 118 (4), 1279-1289 (1993) |
| Title | The human gene for the zona pellucida glycoprotein ZP3 and a second polymorphic locus are located on chromosome 7 . |
| Author | van Duin,M., Polman,J.E., Suikerbuijk,R.F., Geurts-van Kessel,A.H. and Olijve,W. |
| Journal | Cytogenet. Cell Genet. 63 (2), 111-113 (1993) |
| Title | Cloning and characterization of the human sperm receptor ligand ZP3: evidence for a second polymorphic allele with a different frequency in the Caucasian and Japanese populations . |
| Author | van Duin,M., Polman,J.E., Verkoelen,C.C., Bunschoten,H., Meyerink,J.H., Olijve,W. and Aitken,R.J. |
| Journal | Genomics 14 (4), 1064-1070 (1992) |
| Title | Human homolog of the mouse sperm receptor . |
| Author | Chamberlin,M.E. and Dean,J. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 87 (16), 6014-6018 (1990) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |