• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens zona pellucida glycoprotein 3 (sperm receptor) (ZP3), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_001110354 Homo sapiens zona pellucida glycoprotein 3 (sperm receptor) (ZP3), transcript variant 1, mRNA. ORF Sequence $369.75
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001110354.1, 160358849
Length 1317 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens zona pellucida glycoprotein 3 (sperm receptor) (ZP3), transcript variant 1, mRNA.
Product zona pellucida sperm-binding protein 3 isoform 1 precursor
Comment

Summary: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_001103824.1
CDS 11..1285
Misc Feature(1)77..79
Misc Feature(2)143..919
Misc Feature(3)1172..1234
Exon (1)1..322
Gene:ZP3
Gene Synonym:Zp-3; ZP3A; ZP3B; ZPC
Exon (2)323..441
Gene:ZP3
Gene Synonym:Zp-3; ZP3A; ZP3B; ZPC
Exon (3)442..545
Gene:ZP3
Gene Synonym:Zp-3; ZP3A; ZP3B; ZPC
Exon (4)546..723
Gene:ZP3
Gene Synonym:Zp-3; ZP3A; ZP3B; ZPC
Exon (5)724..841
Gene:ZP3
Gene Synonym:Zp-3; ZP3A; ZP3B; ZPC
Exon (6)842..933
Gene:ZP3
Gene Synonym:Zp-3; ZP3A; ZP3B; ZPC
Exon (7)934..1070
Gene:ZP3
Gene Synonym:Zp-3; ZP3A; ZP3B; ZPC
Exon (8)1071..1300
Gene:ZP3
Gene Synonym:Zp-3; ZP3A; ZP3B; ZPC
Translation MELSYRLFICLLLWGSTELCYPQPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLF GTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDP RPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEEN WNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCL VDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKAC SFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADV TVGPLIFLDRRGDHEVEQWALPSDTSVVLLGVGLAVVVSLTLTAVILVLTRRCRTASHPV SASE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
9+dbSNP:
9+c, tdbSNP:111488442
43+c, tdbSNP:148715886
101+c, tdbSNP:2286428
118+c, gdbSNP:117869702
124+c, tdbSNP:199647928
133+c, tdbSNP:114691990
196+c, tdbSNP:115350845
208+c, tdbSNP:142032111
232+c, tdbSNP:143341902
248+a, cdbSNP:202083521
252+c, tdbSNP:151289035
272+g, tdbSNP:140647241
290+a, gdbSNP:150482826
301+c, tdbSNP:142370942
332+dbSNP:
332+a, gdbSNP:144871193
343+a, gdbSNP:142750355
348+a, gdbSNP:140906109
373+c, tdbSNP:182977240
391+c, tdbSNP:144953873
395+a, gdbSNP:144669807
407+c, tdbSNP:149364780
408+a, gdbSNP:138711194
442+dbSNP:
442+g, tdbSNP:199644652
495+c, tdbSNP:200478046
506+g, tdbSNP:144048482
516+a, cdbSNP:199926330
517+a, gdbSNP:201006719
534+a, gdbSNP:200472178
557+dbSNP:
557+a, gdbSNP:74676082
593+a, gdbSNP:141376418
618+a, gdbSNP:147426775
672+c, gdbSNP:139729790
716+c, tdbSNP:145049890
721+c, tdbSNP:199660958
733+dbSNP:
733+c, tdbSNP:112208102
737+a, gdbSNP:147549399
778+a, gdbSNP:112837943
809+c, gdbSNP:17851474
845+dbSNP:
845+c, tdbSNP:139519109
857+c, tdbSNP:149689401
888+c, gdbSNP:145839945
904+a, gdbSNP:73363163
904+c, tdbSNP:79425252
952+dbSNP:
952+a, cdbSNP:148976073
953+a, gdbSNP:2906999
983+a, gdbSNP:146640456
998+c, tdbSNP:191720772
1023+c, tdbSNP:2906998
1028+a, gdbSNP:1056329
1028+c, tdbSNP:2906997
1044+c, gdbSNP:1056338
1044+c, gdbSNP:1804905
1045+a, gdbSNP:138791078
1048+g, tdbSNP:141493396
1092+dbSNP:
1092+c, tdbSNP:4109777
1092+c, tdbSNP:201448034
1093+c, tdbSNP:201735348
1095..1096+, cdbSNP:3215870
1123+a, cdbSNP:711306
1123+g, tdbSNP:200481427
1124+a, cdbSNP:17856528
1140+a, gdbSNP:71539279
1140+a, gdbSNP:143649134
1149+c, tdbSNP:201521728
1184+a, gdbSNP:201251126
1187+c, gdbSNP:4109778
1263+a, gdbSNP:201964956
Gene SymbolZP3
Gene SynonymZp-3; ZP3A; ZP3B; ZPC
Chromosome7
Locus Map7q11.23
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001110354 Homo sapiens zona pellucida glycoprotein 3 (sperm receptor) (ZP3), transcript variant 1, mRNA. Full Length $381.93
ORF Sequence $369.75
NM_007155 Homo sapiens zona pellucida glycoprotein 3 (sperm receptor) (ZP3), transcript variant 2, mRNA. Full Length $433.26
ORF Sequence $325.38
Title Genetic and physiological study of morphologically abnormal human zona pellucida .
Author Margalit,M., Paz,G., Yavetz,H., Yogev,L., Amit,A., Hevlin-Schwartz,T., Gupta,S.K. and Kleiman,S.E.
Journal Eur. J. Obstet. Gynecol. Reprod. Biol. 165 (1), 70-76 (2012)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Identification of human sperm proteins that interact with human zona pellucida3 (ZP3) using yeast two-hybrid system .
Author Naz,R.K. and Dhandapani,L.
Journal J. Reprod. Immunol. 84 (1), 24-31 (2010)
Title Binding characteristics of sperm with recombinant human zona pellucida glycoprotein-3 coated beads .
Author Bansal,P. and Gupta,S.K.
Journal Indian J. Med. Res. 130 (1), 37-43 (2009)
Title Functional activity of human ZP3 primary sperm receptor resides toward its C-terminus .
Author Bansal,P., Chakrabarti,K. and Gupta,S.K.
Journal Biol. Reprod. 81 (1), 7-15 (2009)
Title POM-ZP3, a bipartite transcript derived from human ZP3 and a POM121 homologue .
Author Kipersztok,S., Osawa,G.A., Liang,L.F., Modi,W.S. and Dean,J.
Journal Genomics 25 (2), 354-359 (1995)
Title Sperm require beta-N-acetylglucosaminidase to penetrate through the egg zona pellucida .
Author Miller,D.J., Gong,X. and Shur,B.D.
Journal Development 118 (4), 1279-1289 (1993)
Title The human gene for the zona pellucida glycoprotein ZP3 and a second polymorphic locus are located on chromosome 7 .
Author van Duin,M., Polman,J.E., Suikerbuijk,R.F., Geurts-van Kessel,A.H. and Olijve,W.
Journal Cytogenet. Cell Genet. 63 (2), 111-113 (1993)
Title Cloning and characterization of the human sperm receptor ligand ZP3: evidence for a second polymorphic allele with a different frequency in the Caucasian and Japanese populations .
Author van Duin,M., Polman,J.E., Verkoelen,C.C., Bunschoten,H., Meyerink,J.H., Olijve,W. and Aitken,R.J.
Journal Genomics 14 (4), 1064-1070 (1992)
Title Human homolog of the mouse sperm receptor .
Author Chamberlin,M.E. and Dean,J.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (16), 6014-6018 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878