• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens thymidine phosphorylase (TYMP), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_001113755 Homo sapiens thymidine phosphorylase (TYMP), transcript variant 1, mRNA. ORF Sequence $420.21
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001113755.2, 384229045
Length 1679 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens thymidine phosphorylase (TYMP), transcript variant 1, mRNA.
Product thymidine phosphorylase isoform 1 proprotein
Comment

Summary: This gene encodes an angiogenic factor which promotes angiogenesis in vivo and stimulates the in vitro growth of a variety of endothelial cells. It has a highly restricted target cell specificity acting only on endothelial cells. Mutations in this gene have been associated with mitochondrial neurogastrointestinal encephalomyopathy. Multiple alternatively spliced transcript variants have been identified. [provided by RefSeq, Apr 2012].


Transcript Variant: This variant (1) and variants 2, 3 and 4 encode the same isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001107227.1
CDS 205..1653
Misc Feature(1)97..99
Misc Feature(2)97..99
Misc Feature(3)307..501
Misc Feature(4)313..1542
Misc Feature(5)529..1290
Misc Feature(6)997..1041
Misc Feature(7)1189..1230
Misc Feature(8)1369..1590
Misc Feature(9)1381..1407
Misc Feature(10)1561..1587
Exon (1)1..182
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (2)183..418
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (3)419..621
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (4)622..720
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (5)721..850
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (6)851..969
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (7)970..1132
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (8)1133..1363
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (9)1364..1504
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (10)1505..1671
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Translation MAALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAA VVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGG VGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQA GCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAA VFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPP DLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARAL CSGSPAERRQLLPRAREQEELLAPADGTVELVRALPLALVLHELGAGRSRAGEPLRLGVG AELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSDRAPFAAPSPFAELVLPP QQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(187)-dbSNP:
complement(187)-t, gdbSNP:181234837
complement(315)-t, cdbSNP:143471306
complement(335)-g, adbSNP:28931613
complement(381)-g, adbSNP:137930991
complement(397)-t, cdbSNP:146922557
complement(399)-g, adbSNP:142027728
complement(408)-g, adbSNP:34375653
complement(446)-dbSNP:
complement(446)-t, cdbSNP:143789597
complement(471)-t, cdbSNP:148978792
complement(520)-g, cdbSNP:201513101
complement(605)-g, adbSNP:199901350
complement(637)-dbSNP:
complement(637)-g, adbSNP:121913037
complement(641)-t, cdbSNP:188802138
complement(661)-g, adbSNP:121913038
complement(723)-dbSNP:
complement(723)-t, cdbSNP:146835206
complement(767)-g, cdbSNP:145056860
complement(789)-t, gdbSNP:17851631
complement(809)-g, cdbSNP:121913041
complement(816)-t, cdbSNP:200265761
complement(826)-g, adbSNP:121913039
complement(843)-g, adbSNP:146557523
complement(869)-dbSNP:
complement(869)-t, cdbSNP:149977726
complement(880)-t, cdbSNP:200497106
complement(939)-t, cdbSNP:139223629
complement(991)-dbSNP:
complement(991)-t, cdbSNP:9628204
complement(1035)-t, cdbSNP:8141558
complement(1058)-t, cdbSNP:121913042
complement(1070)-c, adbSNP:121913036
complement(1135)-dbSNP:
complement(1135)-g, cdbSNP:121913040
complement(1176)-g, adbSNP:131804
complement(1488)-dbSNP:
complement(1488)-t, adbSNP:1138404
complement(1597)-dbSNP:
complement(1597)-t, cdbSNP:112723255
complement(1605)-t, cdbSNP:1061205
complement(1616)-t, cdbSNP:11479
complement(1636)-t, cdbSNP:3202236
complement(1645)-g, adbSNP:200735968
Gene SymbolTYMP
Gene SynonymECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Chromosome22
Locus Map22q13.33
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001113755 Homo sapiens thymidine phosphorylase (TYMP), transcript variant 1, mRNA. Full Length $486.91
ORF Sequence $420.21
NM_001113756 Homo sapiens thymidine phosphorylase (TYMP), transcript variant 3, mRNA. Full Length $536.79
ORF Sequence $420.21
NM_001257988 Homo sapiens thymidine phosphorylase (TYMP), transcript variant 4, mRNA. Full Length $498.22
ORF Sequence $420.21
NM_001257989 Homo sapiens thymidine phosphorylase (TYMP), nuclear gene encoding mitochondrial protein, transcript variant 5, mRNA. Full Length $487.78
ORF Sequence $424.56
NM_001953 Homo sapiens thymidine phosphorylase (TYMP), transcript variant 2, mRNA. Full Length $483.43
ORF Sequence $420.21
Title Thymidine phosphorylase enhances reactive oxygen species generation and interleukin-8 expression in human cancer cells .
Author Tabata,S., Ikeda,R., Yamamoto,M., Furukawa,T., Kuramoto,T., Takeda,Y., Yamada,K., Haraguchi,M., Nishioka,Y., Sone,S. and Akiyama,S.
Journal Oncol. Rep. 28 (3), 895-902 (2012)
Title Association of right-sided tumors with high thymidine phosphorylase gene expression levels and the response to oral uracil and tegafur/leucovorin chemotherapy among patients with colorectal cancer .
Author Sadahiro,S., Suzuki,T., Tanaka,A., Okada,K., Nagase,H. and Uchida,J.
Journal Cancer Chemother. Pharmacol. 70 (2), 285-291 (2012)
Title Thymidine phosphorylase inhibits vascular smooth muscle cell proliferation via upregulation of STAT3 .
Author Yue,H., Tanaka,K., Furukawa,T., Karnik,S.S. and Li,W.
Journal Biochim. Biophys. Acta 1823 (8), 1316-1323 (2012)
Title Mitochondrial neurogastrointestinal encephalomyopathy: novel pathogenic mutations in thymidine phosphorylase gene in two Italian brothers .
Author Libernini,L., Lupis,C., Mastrangelo,M., Carrozzo,R., Santorelli,F.M., Inghilleri,M. and Leuzzi,V.
Journal Neuropediatrics 43 (4), 201-208 (2012)
Title Phase II and gene expression analysis trial of neoadjuvant capecitabine plus irinotecan followed by capecitabine-based chemoradiotherapy for locally advanced rectal cancer: Hoosier Oncology Group GI03-53 .
Author Chiorean,E.G., Sanghani,S., Schiel,M.A., Yu,M., Burns,M., Tong,Y., Hinkle,D.T., Coleman,N., Robb,B., LeBlanc,J., Clark,R., Bufill,J., Curie,C., Loehrer,P.J. and Cardenes,H.
Journal Cancer Chemother. Pharmacol. 70 (1), 25-32 (2012)
Title Neurotrophic action of gliostatin on cortical neurons. Identity of gliostatin and platelet-derived endothelial cell growth factor .
Author Asai,K., Nakanishi,K., Isobe,I., Eksioglu,Y.Z., Hirano,A., Hama,K., Miyamoto,T. and Kato,T.
Journal J. Biol. Chem. 267 (28), 20311-20316 (1992)
Title Platelet-derived endothelial cell growth factor has thymidine phosphorylase activity .
Author Usuki,K., Saras,J., Waltenberger,J., Miyazono,K., Pierce,G., Thomason,A. and Heldin,C.H.
Journal Biochem. Biophys. Res. Commun. 184 (3), 1311-1316 (1992)
Title Angiogenic factor .
Author Furukawa,T., Yoshimura,A., Sumizawa,T., Haraguchi,M., Akiyama,S., Fukui,K., Ishizawa,M. and Yamada,Y.
Journal Nature 356 (6371), 668 (1992)
Title Regional localization of the human platelet-derived endothelial cell growth factor (ECGF1) gene to chromosome 22q13 .
Author Stenman,G., Sahlin,P., Dumanski,J.P., Hagiwara,K., Ishikawa,F., Miyazono,K., Collins,V.P. and Heldin,C.H.
Journal Cytogenet. Cell Genet. 59 (1), 22-23 (1992)
Title Organization and chromosomal localization of the human platelet-derived endothelial cell growth factor gene .
Author Hagiwara,K., Stenman,G., Honda,H., Sahlin,P., Andersson,A., Miyazono,K., Heldin,C.H., Ishikawa,F. and Takaku,F.
Journal Mol. Cell. Biol. 11 (4), 2125-2132 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878