• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens thymidine phosphorylase (TYMP), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001113755 Homo sapiens thymidine phosphorylase (TYMP), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_001113755.2, 384229045
Length 1679 bp
Structure linear
Update Date 14-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens thymidine phosphorylase (TYMP), transcript variant 1, mRNA.
Product thymidine phosphorylase isoform 1 proprotein
Comment

Summary: This gene encodes an angiogenic factor which promotes angiogenesis in vivo and stimulates the in vitro growth of a variety of endothelial cells. It has a highly restricted target cell specificity acting only on endothelial cells. Mutations in this gene have been associated with mitochondrial neurogastrointestinal encephalomyopathy. Multiple alternatively spliced transcript variants have been identified. [provided by RefSeq, Apr 2012].


Transcript Variant: This variant (1) and variants 2, 3 and 4 encode the same isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001107227.1
CDS 205..1653
Misc Feature(1)97..99
Misc Feature(2)97..99
Misc Feature(3)307..501
Misc Feature(4)313..1614
Misc Feature(5)529..1224
Misc Feature(6)997..1041
Misc Feature(7)1189..1230
Misc Feature(8)1369..1590
Misc Feature(9)1381..1407
Misc Feature(10)1561..1587
Exon (1)1..182
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (2)183..418
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (3)419..621
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (4)622..720
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (5)721..850
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (6)851..969
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (7)970..1132
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (8)1133..1363
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (9)1364..1504
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Exon (10)1505..1671
Gene:TYMP
Gene Synonym:ECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Translation MAALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAA VVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGG VGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQA GCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAA VFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPP DLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARAL CSGSPAERRQLLPRAREQEELLAPADGTVELVRALPLALVLHELGAGRSRAGEPLRLGVG AELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSDRAPFAAPSPFAELVLPP QQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(187)-dbSNP:
complement(187)-t, gdbSNP:181234837
complement(203)-t, gdbSNP:370124042
complement(232)-t, cdbSNP:377572658
complement(280)-g, cdbSNP:372766037
complement(288)-g, adbSNP:369851492
complement(315)-t, cdbSNP:143471306
complement(335)-g, adbSNP:386576608
complement(340)-t, cdbSNP:374043253
complement(381)-g, adbSNP:137930991
complement(397)-t, cdbSNP:146922557
complement(399)-g, adbSNP:142027728
complement(408)-g, adbSNP:34375653
complement(446)-dbSNP:
complement(446)-t, cdbSNP:143789597
complement(471)-t, cdbSNP:148978792
complement(520)-g, cdbSNP:201513101
complement(530)-t, cdbSNP:370874256
complement(605)-g, adbSNP:199901350
complement(621)-g, cdbSNP:370910119
637+dbSNP:
637+a, gdbSNP:121913037
complement(641)-t, cdbSNP:188802138
661+a, gdbSNP:121913038
complement(698)-t, cdbSNP:376867243
complement(699)-g, adbSNP:372889443
complement(723)-dbSNP:
complement(723)-t, cdbSNP:146835206
complement(767)-g, cdbSNP:145056860
complement(789)-t, gdbSNP:17851631
complement(790)-t, cdbSNP:367723039
809+c, gdbSNP:121913041
complement(816)-t, cdbSNP:200265761
826+a, gdbSNP:121913039
complement(843)-g, adbSNP:146557523
complement(869)-dbSNP:
complement(869)-t, cdbSNP:149977726
complement(879)-t, cdbSNP:371027455
complement(880)-t, cdbSNP:200497106
complement(939)-t, cdbSNP:139223629
complement(946)-t, cdbSNP:376372152
complement(954)-t, cdbSNP:376136076
complement(966)-t, cdbSNP:373478014
complement(991)-dbSNP:
complement(991)-t, cdbSNP:9628204
complement(1007)-t, gdbSNP:369432373
complement(1035)-t, cdbSNP:8141558
1058+c, tdbSNP:121913042
complement(1062)-t, cdbSNP:372421189
1070+a, cdbSNP:121913036
1135+dbSNP:
1135+c, gdbSNP:121913040
complement(1176)-g, adbSNP:131804
complement(1278)-t, cdbSNP:372847627
1488+dbSNP:
1488+a, tdbSNP:1138404
complement(1593)-dbSNP:
complement(1593)-g, adbSNP:373893793
complement(1597)-t, cdbSNP:112723255
1605+c, tdbSNP:1061205
1616+c, tdbSNP:11479
complement(1617)-t, cdbSNP:373094137
1636+c, tdbSNP:3202236
complement(1645)-g, adbSNP:200735968
complement(1647)-t, cdbSNP:377497287
complement(1656)-g, adbSNP:372620403
complement(1663)-t, cdbSNP:369012029
Gene SymbolTYMP
Gene SynonymECGF; ECGF1; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; PDECGF; TP
Chromosome22
Locus Map22q13.33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001257988 Homo sapiens thymidine phosphorylase (TYMP), transcript variant 4, mRNA. On-demand TBD TBD
NM_001257989 Homo sapiens thymidine phosphorylase (TYMP), transcript variant 5, mRNA. On-demand TBD TBD
NM_001113756 Homo sapiens thymidine phosphorylase (TYMP), transcript variant 3, mRNA. On-demand TBD TBD
NM_001113755 Homo sapiens thymidine phosphorylase (TYMP), transcript variant 1, mRNA. On-demand TBD TBD
NM_001953 Homo sapiens thymidine phosphorylase (TYMP), transcript variant 2, mRNA. On-demand TBD TBD
Title Thymidine phosphorylase expression in B-cell lymphomas and its significance: a new prognostic marker? .
Author Nie,X., Clifford,P.M., Bhat,R., Heintzelman,R., Abraham,M. and Hou,J.S.
Journal Anal. Quant. Cytol. Histol. 35 (6), 301-305 (2013)
Title A polymorphism in the TYMP gene is associated with the outcome of HLA-identical sibling allogeneic stem cell transplantation .
Author Guillem V, Hernandez-Boluda JC, Gallardo D, Buno I, Bosch A, Martinez-Laperche C, de la Camara R, Brunet S, Martin C, Nieto JB, Martinez C, Perez A, Montoro J, Garcia-Noblejas A and Solano C.
Journal Am. J. Hematol. 88 (10), 883-889 (2013)
Title [Expression of vascular growth factors in intestinal tissues in colorectal carcinoma patients with schistosomiasis japonica] .
Author Ruan SL, Wang B, Lu QM, Dong LR, Cao CX, Xu SL and Shen WY.
Journal Zhongguo Xue Xi Chong Bing Fang Zhi Za Zhi 25 (3), 250-254 (2013)
Title Interferon-alpha enhances 5'-deoxy-5-fluorouridine-induced apoptosis by ERK-dependant upregulation of thymidine phosphorylase .
Author Zhu Y, Xu L, Fan Y, Li C, Zhang Y, Zheng H, Hou K, Qu X and Liu Y.
Journal Biomed Res Int 2013, 132793 (2013)
Title Seventy-five genetic loci influencing the human red blood cell .
Author van der Harst P, Zhang W, Mateo Leach I, Rendon A, Verweij N, Sehmi J, Paul DS, Elling U, Allayee H, Li X, Radhakrishnan A, Tan ST, Voss K, Weichenberger CX, Albers CA, Al-Hussani A, Asselbergs FW, Ciullo M, Danjou F, Dina C, Esko T, Evans DM, Franke L, Gogele M, Hartiala J, Hersch M, Holm H, Hottenga JJ, Kanoni S, Kleber ME, Lagou V, Langenberg C, Lopez LM, Lyytikainen LP, Melander O, Murgia F, Nolte IM, O'Reilly PF, Padmanabhan S, Parsa A, Pirastu N, Porcu E, Portas L, Prokopenko I, Ried JS, Shin SY, Tang CS, Teumer A, Traglia M, Ulivi S, Westra HJ, Yang J, Zhao JH, Anni F, Abdellaoui A, Attwood A, Balkau B, Bandinelli S, Bastardot F, Benyamin B, Boehm BO, Cookson WO, Das D, de Bakker PI, de Boer RA, de Geus EJ, de Moor MH, Dimitriou M, Domingues FS, Doring A, Engstrom G, Eyjolfsson GI, Ferrucci L, Fischer K, Galanello R, Garner SF, Genser B, Gibson QD, Girotto G, Gudbjartsson DF, Harris SE, Hartikainen AL, Hastie CE, Hedblad B, Illig T, Jolley J, Kahonen M, Kema IP, Kemp JP, Liang L, Lloyd-Jones H, Loos RJ, Meacham S, Medland SE, Meisinger C, Memari Y, Mihailov E, Miller K, Moffatt MF, Nauck M, Novatchkova M, Nutile T, Olafsson I, Onundarson PT, Parracciani D, Penninx BW, Perseu L, Piga A, Pistis G, Pouta A, Puc U, Raitakari O, Ring SM, Robino A, Ruggiero D, Ruokonen A, Saint-Pierre A, Sala C, Salumets A, Sambrook J, Schepers H, Schmidt CO, Sillje HH, Sladek R, Smit JH, Starr JM, Stephens J, Sulem P, Tanaka T, Thorsteinsdottir U, Tragante V, van Gilst WH, van Pelt LJ, van Veldhuisen DJ, Volker U, Whitfield JB, Willemsen G, Winkelmann BR, Wirnsberger G, Algra A, Cucca F, d'Adamo AP, Danesh J, Deary IJ, Dominiczak AF, Elliott P, Fortina P, Froguel P, Gasparini P, Greinacher A, Hazen SL, Jarvelin MR, Khaw KT, Lehtimaki T, Maerz W, Martin NG, Metspalu A, Mitchell BD, Montgomery GW, Moore C, Navis G, Pirastu M, Pramstaller PP, Ramirez-Solis R, Schadt E, Scott J, Shuldiner AR, Smith GD, Smith JG, Snieder H, Sorice R, Spector TD, Stefansson K, Stumvoll M, Tang WH, Toniolo D, Tonjes A, Visscher PM, Vollenweider P, Wareham NJ, Wolffenbuttel BH, Boomsma DI, Beckmann JS, Dedoussis GV, Deloukas P, Ferreira MA, Sanna S, Uda M, Hicks AA, Penninger JM, Gieger C, Kooner JS, Ouwehand WH, Soranzo N and Chambers JC.
Journal Nature 492 (7429), 369-375 (2012)
Title Mitochondrial Neurogastrointestinal Encephalopathy Disease .
Author Shoffner,J.M.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Neurotrophic action of gliostatin on cortical neurons. Identity of gliostatin and platelet-derived endothelial cell growth factor .
Author Asai K, Nakanishi K, Isobe I, Eksioglu YZ, Hirano A, Hama K, Miyamoto T and Kato T.
Journal J. Biol. Chem. 267 (28), 20311-20316 (1992)
Title Platelet-derived endothelial cell growth factor has thymidine phosphorylase activity .
Author Usuki K, Saras J, Waltenberger J, Miyazono K, Pierce G, Thomason A and Heldin CH.
Journal Biochem. Biophys. Res. Commun. 184 (3), 1311-1316 (1992)
Title Angiogenic factor .
Author Furukawa,T., Yoshimura,A., Sumizawa,T., Haraguchi,M., Akiyama,S., Fukui,K., Ishizawa,M. and Yamada,Y.
Journal Nature 356 (6371), 668 (1992)
Title Regional localization of the human platelet-derived endothelial cell growth factor (ECGF1) gene to chromosome 22q13 .
Author Stenman G, Sahlin P, Dumanski JP, Hagiwara K, Ishikawa F, Miyazono K, Collins VP and Heldin CH.
Journal Cytogenet. Cell Genet. 59 (1), 22-23 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.