• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001117 Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_001117.4, 452085176
Length 3259 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, mRNA.
Product pituitary adenylate cyclase-activating polypeptide preproprotein
Comment

Summary: This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013].


Transcript Variant: This variant (2) differs in the 5' UTR, compared to variant 1. Variants 1 and 2 both encode the same protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_001108.2
CDS 192..722
Misc Feature(1)438..518
Misc Feature(2)585..665
Exon (1)1..301
Gene:ADCYAP1
Gene Synonym:PACAP
Exon (2)302..433
Gene:ADCYAP1
Gene Synonym:PACAP
Exon (3)434..532
Gene:ADCYAP1
Gene Synonym:PACAP
Exon (4)533..3259
Gene:ADCYAP1
Gene Synonym:PACAP
Translation MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPG AGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGG AGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
5+dbSNP:
5+a, tdbSNP:12605354
6..7+, adbSNP:201296866
complement(7)-t, adbSNP:1893153
83+c, tdbSNP:373510219
88+c, tdbSNP:111709874
159+c, gdbSNP:375496130
232+a, gdbSNP:377558347
273+a, gdbSNP:8192594
279+a, gdbSNP:373051517
284+c, gdbSNP:35305428
317+dbSNP:
317+a, gdbSNP:8192597
327+c, gdbSNP:182986053
352+a, gdbSNP:2856966
404+c, tdbSNP:78094828
442+dbSNP:
442+c, tdbSNP:75827920
457+a, gdbSNP:139671216
458+c, tdbSNP:149799520
463+c, tdbSNP:146950918
465+a, tdbSNP:367884952
468+a, cdbSNP:144732014
493+a, cdbSNP:372460905
511+c, tdbSNP:372357255
512+g, tdbSNP:369947878
515+c, tdbSNP:148570945
526+a, gdbSNP:200379850
551+dbSNP:
551+a, cdbSNP:367797970
634+a, tdbSNP:372391602
647+a, gdbSNP:2231187
655+a, cdbSNP:372417680
669+a, tdbSNP:11540551
671+g, tdbSNP:369209323
672+a, cdbSNP:146643561
686+c, gdbSNP:186853700
705+c, gdbSNP:199812942
720+c, tdbSNP:200627598
739+a, gdbSNP:113395599
750+a, cdbSNP:190047341
751+c, tdbSNP:369093915
753+a, gdbSNP:2231188
755+c, tdbSNP:2231189
765+c, tdbSNP:369091160
797+c, tdbSNP:2231190
797+c, tdbSNP:386467891
961..974+, atatatatatatatdbSNP:147221355
961..970+, atatatatatdbSNP:67164633
961..962+, atdbSNP:376815478
970+c, tdbSNP:62080098
984..993+, tatatatatadbSNP:35018620
984+c, tdbSNP:182226418
1021+g, tdbSNP:28517455
1046+g, tdbSNP:187183412
1189+a, gdbSNP:142179366
1191+c, tdbSNP:114962297
1204+c, tdbSNP:9959930
1237+c, gdbSNP:150841751
1428+a, cdbSNP:139318048
1446+c, tdbSNP:149971122
1505+c, tdbSNP:71352971
1524+a, gdbSNP:114060579
1647+a, gdbSNP:115067101
complement(1654)-g, cdbSNP:1006567
1721+a, gdbSNP:1610037
1741+c, tdbSNP:191206837
1816+c, tdbSNP:182254448
1818+a, gdbSNP:185441467
1904+a, gdbSNP:140753323
1966+, tdbSNP:34903313
1976+, tdbSNP:398031826
2297+c, gdbSNP:62080099
2342+a, cdbSNP:190166278
2354+c, tdbSNP:182760479
2356+c, tdbSNP:188534866
2385+c, tdbSNP:191633083
2463+, adbSNP:66502625
complement(2463)-t, adbSNP:2846813
2466..2467+, tdbSNP:111646130
2467+, adbSNP:201215318
2467+a, tdbSNP:2689003
2474..2475+, tdbSNP:60372265
2507+a, gdbSNP:183868799
2514..2515+, adbSNP:371204243
2736+g, tdbSNP:144512876
2752+a, tdbSNP:79120479
2752+a, tdbSNP:386467802
2761+a, gdbSNP:112124379
2810+c, gdbSNP:192669197
2988+c, tdbSNP:368093870
3191+c, tdbSNP:141319752
Gene SymbolADCYAP1
Gene SynonymPACAP
Chromosome18
Locus Map18p11
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001099733 Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, mRNA. On-demand TBD TBD
NM_001117 Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, mRNA. On-demand TBD TBD
XM_005258081 PREDICTED: Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant X1, mRNA. On-demand TBD TBD
Title Vasoactive intestinal peptide (VIP) and pituitary adenylate cyclase activating polypeptide (PACAP) in humans with multiple sclerosis .
Author Baranowska-Bik A, Kochanowski J, Uchman D, Wolinska-Witort E, Kalisz M, Martynska L, Baranowska B and Bik W.
Journal J. Neuroimmunol. 263 (1-2), 159-161 (2013)
Title Alterations in PACAP-38-like immunoreactivity in the plasma during ictal and interictal periods of migraine patients .
Author Tuka B, Helyes Z, Markovics A, Bagoly T, Szolcsanyi J, Szabo N, Toth E, Kincses ZT, Vecsei L and Tajti J.
Journal Cephalalgia 33 (13), 1085-1095 (2013)
Title Characterization of the testis-specific promoter region in the human pituitary adenylate cyclase-activating polypeptide (PACAP) gene .
Author Tominaga A, Sugawara H, Futagawa T, Inoue K, Sasaki K, Minamino N, Hatakeyama M, Handa H and Miyata A.
Journal Genes Cells 15 (6), 595-606 (2010)
Title Pituitary adenylate cyclase-activating polypeptide and its receptors: 20 years after the discovery .
Author Vaudry D, Falluel-Morel A, Bourgault S, Basille M, Burel D, Wurtz O, Fournier A, Chow BK, Hashimoto H, Galas L and Vaudry H.
Journal Pharmacol. Rev. 61 (3), 283-357 (2009)
Title Chief cells possess a receptor with high affinity for PACAP and VIP that stimulates pepsinogen release .
Author Felley CP, Qian JM, Mantey S, Pradhan T and Jensen RT.
Journal Am. J. Physiol. 263 (6 PT 1), G901-G907 (1992)
Title Pituitary adenylate cyclase activating polypeptide (PACAP) with 27 residues. Conformation determined by 1H NMR and CD spectroscopies and distance geometry in 25% methanol solution .
Author Inooka H, Endo S, Kitada C, Mizuta E and Fujino M.
Journal Int. J. Pept. Protein Res. 40 (5), 456-464 (1992)
Title Expression of human pituitary adenylate cyclase activating polypeptide (PACAP) cDNA in CHO cells and characterization of the products .
Author Okazaki K, Kimura C, Kosaka T, Watanabe T, Ohkubo S, Ogi K, Kitada C, Onda H and Fujino M.
Journal FEBS Lett. 298 (1), 49-56 (1992)
Title Structure of the human pituitary adenylate cyclase activating polypeptide (PACAP) gene .
Author Hosoya M, Kimura C, Ogi K, Ohkubo S, Miyamoto Y, Kugoh H, Shimizu M, Onda H, Oshimura M and Arimura A.
Journal Biochim. Biophys. Acta 1129 (2), 199-206 (1992)
Title Primary structure and characterization of the precursor to human pituitary adenylate cyclase activating polypeptide .
Author Ohkubo S, Kimura C, Ogi K, Okazaki K, Hosoya M, Onda H, Miyata A, Arimura A and Fujino M.
Journal DNA Cell Biol. 11 (1), 21-30 (1992)
Title A novel peptide which stimulates adenylate cyclase: molecular cloning and characterization of the ovine and human cDNAs .
Author Kimura C, Ohkubo S, Ogi K, Hosoya M, Itoh Y, Onda H, Miyata A, Jiang L, Dahl RR and Stibbs HH.
Journal Biochem. Biophys. Res. Commun. 166 (1), 81-89 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.