• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001117 Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_001117.4, 452085176
Length 3259 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, mRNA.
Product pituitary adenylate cyclase-activating polypeptide preproprotein
Comment

Summary: This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013].


Transcript Variant: This variant (2) differs in the 5' UTR, compared to variant 1. Variants 1 and 2 both encode the same protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_001108.2
CDS 192..722
Misc Feature(1)438..509
Misc Feature(2)585..665
Exon (1)1..301
Gene:ADCYAP1
Gene Synonym:PACAP
Exon (2)302..433
Gene:ADCYAP1
Gene Synonym:PACAP
Exon (3)434..532
Gene:ADCYAP1
Gene Synonym:PACAP
Exon (4)533..3259
Gene:ADCYAP1
Gene Synonym:PACAP
Translation MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPG AGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGG AGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolADCYAP1
Gene SynonymPACAP
Chromosome18
Locus Map18p11
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001099733 Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, mRNA. On-demand TBD TBD
NM_001117 Homo sapiens adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, mRNA. On-demand TBD TBD
Title PACAP immunoreactivity in human malignant tumor samples and cardiac diseases .
Author Szanto,Z., Sarszegi,Z., Reglodi,D., Nemeth,J., Szabadfi,K., Kiss,P., Varga,A., Banki,E., Csanaky,K., Gaszner,B., Pinter,O., Szalai,Z. and Tamas,A.
Journal J. Mol. Neurosci. 48 (3), 667-673 (2012)
Title Effects of PACAP on intracellular signaling pathways in human retinal pigment epithelial cells exposed to oxidative stress .
Author Fabian,E., Reglodi,D., Mester,L., Szabo,A., Szabadfi,K., Tamas,A., Toth,G. and Kovacs,K.
Journal J. Mol. Neurosci. 48 (3), 493-500 (2012)
Title Characterization of the testis-specific promoter region in the human pituitary adenylate cyclase-activating polypeptide (PACAP) gene .
Author Tominaga,A., Sugawara,H., Futagawa,T., Inoue,K., Sasaki,K., Minamino,N., Hatakeyama,M., Handa,H. and Miyata,A.
Journal Genes Cells 15 (6), 595-606 (2010)
Title Pituitary adenylate cyclase-activating polypeptide and its receptors: 20 years after the discovery .
Author Vaudry,D., Falluel-Morel,A., Bourgault,S., Basille,M., Burel,D., Wurtz,O., Fournier,A., Chow,B.K., Hashimoto,H., Galas,L. and Vaudry,H.
Journal Pharmacol. Rev. 61 (3), 283-357 (2009)
Title Chief cells possess a receptor with high affinity for PACAP and VIP that stimulates pepsinogen release .
Author Felley,C.P., Qian,J.M., Mantey,S., Pradhan,T. and Jensen,R.T.
Journal Am. J. Physiol. 263 (6 PT 1), G901-G907 (1992)
Title Pituitary adenylate cyclase activating polypeptide (PACAP) with 27 residues. Conformation determined by 1H NMR and CD spectroscopies and distance geometry in 25% methanol solution .
Author Inooka,H., Endo,S., Kitada,C., Mizuta,E. and Fujino,M.
Journal Int. J. Pept. Protein Res. 40 (5), 456-464 (1992)
Title Expression of human pituitary adenylate cyclase activating polypeptide (PACAP) cDNA in CHO cells and characterization of the products .
Author Okazaki,K., Kimura,C., Kosaka,T., Watanabe,T., Ohkubo,S., Ogi,K., Kitada,C., Onda,H. and Fujino,M.
Journal FEBS Lett. 298 (1), 49-56 (1992)
Title Structure of the human pituitary adenylate cyclase activating polypeptide (PACAP) gene .
Author Hosoya,M., Kimura,C., Ogi,K., Ohkubo,S., Miyamoto,Y., Kugoh,H., Shimizu,M., Onda,H., Oshimura,M., Arimura,A. et al.
Journal Biochim. Biophys. Acta 1129 (2), 199-206 (1992)
Title Primary structure and characterization of the precursor to human pituitary adenylate cyclase activating polypeptide .
Author Ohkubo,S., Kimura,C., Ogi,K., Okazaki,K., Hosoya,M., Onda,H., Miyata,A., Arimura,A. and Fujino,M.
Journal DNA Cell Biol. 11 (1), 21-30 (1992)
Title A novel peptide which stimulates adenylate cyclase: molecular cloning and characterization of the ovine and human cDNAs .
Author Kimura,C., Ohkubo,S., Ogi,K., Hosoya,M., Itoh,Y., Onda,H., Miyata,A., Jiang,L., Dahl,R.R., Stibbs,H.H. et al.
Journal Biochem. Biophys. Res. Commun. 166 (1), 81-89 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.