• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens killin, p53-regulated DNA replication inhibitor (KLLN), mRNA.


RefSeq Accession Definition Services Price Order
NM_001126049 Homo sapiens killin, p53-regulated DNA replication inhibitor (KLLN), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001126049.1, 186700630
Length 4277 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens killin, p53-regulated DNA replication inhibitor (KLLN), mRNA.
Product killin
Comment

Summary: The protein encoded by this intronless gene is found in the nucleus, where it can inhibit DNA synthesis and promote S phase arrest coupled to apoptosis. The expression of this DNA binding protein is upregulated by transcription factor p53. [provided by RefSeq, Dec 2012].


##Evidence-Data-START## Transcript exon combination :: EU552092.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_001119521.1
CDS 951..1487
Misc Feature(1)936..938
Exon (1)1..4277
Gene:KLLN
Gene Synonym:CWS4; KILLIN
Translation MDRPGPGSARPGRTVHVWGYRVEWKVRNGRKLQPSEWAGRGDLGGFKRRWKDTRATVGTT FRRRSRVSLVGELSKFPLPSDSSGGKSSSSFARGALAWCRQRNPNPSCAAAETGARTSLP KERCRGWRLGNWLHKHPHPNTCPRLPACWLPPILTERGERVPKLVPLLACYPKSKPKD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(28)-dbSNP:
complement(28)-g, cdbSNP:144620057
complement(114)-c, adbSNP:112758888
complement(167)-c, adbSNP:201263396
complement(280)-t, cdbSNP:70937047
complement(521)-t, cdbSNP:140692322
complement(545)-t, adbSNP:150923050
complement(548)-g, adbSNP:115389083
complement(628)-g, adbSNP:183905591
complement(656)-t, cdbSNP:114717956
complement(741..749)-, gccctttggdbSNP:140280016
complement(860)-g, adbSNP:192286047
complement(934)-g, adbSNP:143510676
complement(999)-dbSNP:
complement(999)-t, cdbSNP:201100551
complement(1080)-g, cdbSNP:186106725
complement(1200)-g, cdbSNP:3758479
complement(1261)-g, cdbSNP:148838695
complement(1332)-g, cdbSNP:201652303
complement(1342)-t, cdbSNP:147932146
complement(1395)-t, adbSNP:144811392
complement(1411)-g, adbSNP:188648297
complement(1469)-t, cdbSNP:185550921
complement(1540)-g, adbSNP:181069579
complement(1606)-, cdbSNP:35361056
complement(1743)-t, cdbSNP:141066244
complement(1799)-t, cdbSNP:147739023
complement(1950)-t, gdbSNP:190019605
complement(2058)-c, adbSNP:185094431
complement(2134)-t, cdbSNP:7901097
complement(2315)-t, cdbSNP:193149038
complement(2376)-t, gdbSNP:190576098
complement(2467)-t, cdbSNP:149992281
complement(2609)-g, cdbSNP:183894316
complement(2612)-g, adbSNP:191518084
complement(2655)-g, adbSNP:56389051
complement(2812)-g, adbSNP:186662792
complement(2890)-t, cdbSNP:116928332
complement(2929)-t, cdbSNP:184216900
complement(2985)-g, adbSNP:1903860
complement(3021)-g, adbSNP:80005718
complement(3064)-g, adbSNP:191630598
complement(3199)-t, cdbSNP:139261693
complement(3240)-g, adbSNP:188576792
complement(3342)-c, adbSNP:183638448
complement(3403)-g, adbSNP:113730541
complement(3422..3423)-, adbSNP:5786795
complement(3464)-t, cdbSNP:192064705
complement(3488)-t, cdbSNP:188956302
complement(3587)-t, cdbSNP:150816814
complement(3650)-g, adbSNP:141469860
complement(3682)-t, gdbSNP:78839565
complement(3683)-t, cdbSNP:140073260
complement(3700)-t, cdbSNP:60373064
complement(3744)-t, cdbSNP:183136843
complement(3835)-g, adbSNP:189765659
complement(3836)-t, cdbSNP:184914771
complement(3846)-c, adbSNP:181205569
complement(3905)-c, adbSNP:75742574
complement(3970)-g, cdbSNP:77542800
complement(4265)-t, adbSNP:76631158
Gene SymbolKLLN
Gene SynonymCWS4; KILLIN
Chromosome10
Locus Map10q23
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001126049 Homo sapiens killin, p53-regulated DNA replication inhibitor (KLLN), mRNA. Full Length $1496.95
ORF Sequence $159.00
Title Analysis of KLLN as a high-penetrance breast cancer predisposition gene .
Author Thompson,E.R., Gorringe,K.L., Choong,D.Y., Eccles,D.M., Mitchell,G. and Campbell,I.G.
Journal Breast Cancer Res. Treat. 134 (2), 543-547 (2012)
Title Incidence and clinical characteristics of thyroid cancer in prospective series of individuals with Cowden and Cowden-like syndrome characterized by germline PTEN, SDH, or KLLN alterations .
Author Ngeow,J., Mester,J., Rybicki,L.A., Ni,Y., Milas,M. and Eng,C.
Journal J. Clin. Endocrinol. Metab. 96 (12), E2063-E2071 (2011)
Title Germline and somatic DNA methylation and epigenetic regulation of .
Author Bennett,K.L., Campbell,R., Ganapathi,S., Zhou,M., Rini,B., Ganapathi,R., Neumann,H.P. and Eng,C.
Journal Genes Chromosomes Cancer 50 (8), 654-661 (2011)
Title Germline epigenetic regulation of KILLIN in Cowden and Cowden-like syndrome .
Author Bennett,K.L., Mester,J. and Eng,C.
Journal JAMA 304 (24), 2724-2731 (2010)
Title Killin is a p53-regulated nuclear inhibitor of DNA synthesis .
Author Cho,Y.J. and Liang,P.
Journal Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5396-5401 (2008)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878