Sequence in raw or FASTA format:
Homo sapiens killin, p53-regulated DNA replication inhibitor (KLLN), mRNA.
| RefSeq Version | NM_001126049.1, 186700630 |
| Length | 4277 bp |
| Structure | linear |
| Update Date | 11-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens killin, p53-regulated DNA replication inhibitor (KLLN), mRNA. |
| Product | killin |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from EU552092.1. |
| RefSeq | NP_001119521.1 |
| CDS | 951..1487 | Exon (1) | 1..4277 | Exon (2) | 1..4277 |
| Translation | MDRPGPGSARPGRTVHVWGYRVEWKVRNGRKLQPSEWAGRGDLGGFKRRWKDTRATVGTT
FRRRSRVSLVGELSKFPLPSDSSGGKSSSSFARGALAWCRQRNPNPSCAAAETGARTSLP
KERCRGWRLGNWLHKHPHPNTCPRLPACWLPPILTERGERVPKLVPLLACYPKSKPKD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(114) | - | c, a | dbSNP:112758888 |
| complement(127) | - | g, a | dbSNP:79481638 |
| complement(167) | - | c, a | dbSNP:114232295 |
| complement(280) | - | t, c | dbSNP:70937047 |
| complement(548) | - | g, a | dbSNP:115389083 |
| complement(656) | - | t, c | dbSNP:114717956 |
| 1200 | + | dbSNP: | |
| 1200 | + | c, g | dbSNP:3758479 |
| complement(1604) | - | , c | dbSNP:35361056 |
| complement(2058) | - | c, a | dbSNP:114114358 |
| complement(2134) | - | t, c | dbSNP:7901097 |
| complement(2655) | - | g, a | dbSNP:56389051 |
| complement(2890) | - | t, c | dbSNP:116928332 |
| 2985 | + | a, g | dbSNP:1903860 |
| complement(3021) | - | g, a | dbSNP:80005718 |
| complement(3403) | - | g, a | dbSNP:113730541 |
| complement(3422..3423) | - | , a | dbSNP:5786795 |
| complement(3682) | - | t, g | dbSNP:78839565 |
| complement(3700) | - | t, c | dbSNP:60373064 |
| complement(3905) | - | c, a | dbSNP:75742574 |
| complement(3970) | - | g, c | dbSNP:77542800 |
| complement(4265) | - | t, a | dbSNP:76631158 |
| Gene Symbol | KLLN |
| Gene Synonym | KILLIN |
| Chromosome | 10 |
| Locus Map | 10q23 |
| All Transcripts | NM_001126049 |
| Title | Germline epigenetic regulation of KILLIN in Cowden and Cowden-like syndrome . |
| Author | Bennett,K.L., Mester,J. and Eng,C. |
| Journal | JAMA 304 (24), 2724-2731 (2010) |
| Title | Killin is a p53-regulated nuclear inhibitor of DNA synthesis . |
| Author | Cho,Y.J. and Liang,P. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5396-5401 (2008) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |