Homo sapiens acyl-CoA synthetase family member 3 (ACSF3), nuclear gene encoding mitochondrial protein, transcript variant 2, mRNA.
| RefSeq Version | NM_001127214.1, 187761344 |
| Length | 2284 bp |
| Structure | linear |
| Update Date | 11-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens acyl-CoA synthetase family member 3 (ACSF3), nuclear gene encoding mitochondrial protein, transcript variant 2, mRNA. |
| Product | acyl-CoA synthetase family member 3, mitochondrial precursor |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DA062861.1, AK290963.1 and BC064609.1. Transcript Variant: This variant (2) omits an alternate exon in the 5' UTR. |
| RefSeq | NP_001120686.1 |
| CDS | 172..1902 | Exon (1) | 1..151 | Exon (2) | 1..151 | Exon (3) | 152..837 | Exon (4) | 838..993 | Exon (5) | 994..1148 | Exon (6) | 1149..1297 | Exon (7) | 1298..1410 | Exon (8) | 1411..1537 | Exon (9) | 1538..1672 | Exon (10) | 1673..1784 | Exon (11) | 1785..2284 |
| Translation | MLPHVVLTFRRLGCALASCRLAPARHRGSGLLHTAPVARSDRSAPVFTRALAFGDRIALV
DQHGRHTYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCANDASYVVAQWASWMSGG
VAVPLYRKHPAAQLEYVICDSQSSVVLASQEYLELLSPVVRKLGVPLLPLTPAIYTGAVE
EPAEVPVPEQGWRNKGAMIIYTSGTTGRPKGVLSTHQNIRAVVTGLVHKWAWTKDDVILH
VLPLHHVHGVVNALLCPLWVGATCVMMPEFSPQQVWEKFLSSETPRINVFMAVPTIYTKL
MEYYDRHFTQPHAQDFLRAVCEEKIRLMVSGSAALPLPVLEKWKNITGHTLLERYGMTEI
GMALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHAEGDERGTKVTPGFEE
KEGELLVRGPSVFREYWNKPEETKSAFTLDGWFKTGDTVVFKDGQYWIRGRTSVDIIKTG
GYKVSALEVEWHLLAHPSITDVAVIGVPDMTWGQRVTAVVTLREGHSLSHRELKEWARNV
LAPYAVPSELVLVEEIPRNQMGKIDKKALIRHFHPS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Gene Symbol | ACSF3 |
| Gene Synonym | FLJ39242 |
| Chromosome | 16 |
| Locus Map | 16q24.3 |
| All Transcripts | NM_001127214 , NM_174917 |
| Title | Genetic variants in nuclear-encoded mitochondrial genes influence . |
| Author | Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M., Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D., Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J. |
| Journal | PLoS ONE 5 (9), E12862 (2010) |
| Title | Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome . |
| Author | Watkins,P.A., Maiguel,D., Jia,Z. and Pevsner,J. |
| Journal | J. Lipid Res. 48 (12), 2736-2750 (2007) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
| Secured Online Quotation | |
| Email: gene@genscript.com | |
| Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 | |
| Fax: 1-732-210-0262 1-732-885-5878 |

