• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens adenomatous polyposis coli (APC), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001127510 Homo sapiens adenomatous polyposis coli (APC), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $4749.00 40

*Business Day

Related Services

RefSeq Version NM_001127510.2, 307133685
Length 10848 bp
Structure linear
Update Date 20-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens adenomatous polyposis coli (APC), transcript variant 2, mRNA.
Product adenomatous polyposis coli protein isoform b
Comment

Summary: This gene encodes a tumor suppressor protein that acts as an antagonist of the Wnt signaling pathway. It is also involved in other processes including cell migration and adhesion, transcriptional activation, and apoptosis. Defects in this gene cause familial adenomatous polyposis (FAP), an autosomal dominant pre-malignant disease that usually progresses to malignancy. Disease-associated mutations tend to be clustered in a small region designated the mutation cluster region (MCR) and result in a truncated protein product. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at an alternate start codon, compared to variant 1. This variant also contains an alternate in-frame exon compared to variant 1. The encoded isoform (b) has a distinct N-terminus and is longer than isoform a. Variants 2 and 3 encode the same isoform (b).

RefSeq NP_001120982.1
CDS 194..8725
Misc Feature(1)185..187
Misc Feature(2)197..199
Misc Feature(3)197..199
Misc Feature(4)569..817
Misc Feature(5)1124..1432
Misc Feature(6)order(1184..1186,1196..1198,1208..1210,1292..1294,
Misc Feature(7)1550..1678
Misc Feature(8)1583..1984
Misc Feature(9)order(1688..1690,1700..1702,1712..1714,1808..1810,
Misc Feature(10)1706..1834
Misc Feature(11)1835..1966
Misc Feature(12)1967..2107
Misc Feature(13)2024..2386
Misc Feature(14)order(2090..2092,2102..2104,2114..2116,2216..2218,
Misc Feature(15)2108..2242
Misc Feature(16)2243..2368
Misc Feature(17)2369..2494
Misc Feature(18)2423..2425
Misc Feature(19)2531..2533
Misc Feature(20)3071..4204
Misc Feature(21)3317..3319
Misc Feature(22)4271..4273
Misc Feature(23)4298..4375
Misc Feature(24)5099..5176
Misc Feature(25)5348..5407
Misc Feature(26)5774..5776
Misc Feature(27)5780..5782
Misc Feature(28)5783..5785
Misc Feature(29)5789..5872
Misc Feature(30)6293..6352
Misc Feature(31)6644..6646
Misc Feature(32)6860..7897
Misc Feature(33)6971..6973
Misc Feature(34)7001..7003
Misc Feature(35)7040..7042
Misc Feature(36)7610..7612
Misc Feature(37)7796..7798
Misc Feature(38)8201..8722
Misc Feature(39)8204..8206
Misc Feature(40)8213..8215
Misc Feature(41)8228..8230
Misc Feature(42)8558..8560
Misc Feature(43)8600..8611
Misc Feature(44)8714..8722
Exon (1)1..67
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (2)68..175
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (3)176..328
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (4)329..413
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (5)414..615
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (6)616..724
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (7)725..838
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (8)839..922
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (9)923..1027
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (10)1028..1126
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (11)1127..1505
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (12)1506..1601
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (13)1602..1741
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (14)1742..1819
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (15)1820..1936
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (16)1937..2151
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (17)2152..10838
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Translation MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR RGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQAT EAERSSQNKHETGSHDAERQNEGQGVGEINMATSGNGQGSTTRMDHETASVLSSSSTHSA PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC WEWQEAHEPGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ VDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENN CLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAM GSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLS PKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGS LDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTS QEDRSSGSTTELHCVTDERNALRRSSAAHTHSNTYNFTKSENSNRTCSMPYAKLEYKRSS NDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGE LDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTE STDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP TNYSERYSEEEQHEEEERPTNYSIKYNEEKRHVDQPIDYSLKYATDIPSSQKQSFSFSKS SSGQSSKTEHMSSSSENTSTPSSNAKRQNQLHPSSAQSRSGQPQKAATCKVSSINQETIQ TYCVEDTPICFSRCSSLSSLSSAEDEIGCNQTTQEADSANTLQIAEIKEKIGTRSAEDPV SEVPAVSQHPRTKSSRLQGSSLSSESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQET PLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPP PPPQTAQTKREVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGF SCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNENQEKEAEKTIDSE KDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPS QNRLQPQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRGGAQ SGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKP FRVKKIMDQVQQASASSSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLN AERVFSDNKDSKKQNLKNNSKVFNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRND SLSSLDFDDDDVDLSREKAELRKAKENKESEAKVTSHTELTSNQQSANKTQAIAKQPINR GQPKPILQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSHNSSLSSLSDIDQENN NKENEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQ ECISSAMPKKKKPSRLKGDNEKHSPRNMGGILGEDLTLDLKDIQRPDSEHGLSPDSENFD WKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFT SNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQAN MPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVKS ELSPVARQTSQIGGSSKAPSRSGSRDSTPSRPAQQPLSRPIQSPGRNSISPGRNGISPPN KLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASKG LNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEESA SFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYNDG RPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSES SEKAKSEDEKHVNSISGTKQSKENQVSAKGTWRKIKENEFSPTNSTSQTVSSGATNGAES KTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKANPNIKDSKDN QAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTEIKPGQNNPVPVSETNESSIVERT PFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKT DSTESSGTQSPKRHSGSYLVTSV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
2+dbSNP:
2+g, tdbSNP:75996864
16+c, gdbSNP:115242894
116+dbSNP:
116+a, gdbSNP:113366062
178+dbSNP:
178+c, tdbSNP:371665872
207+c, tdbSNP:373718658
246+a, tdbSNP:200960071
260+c, gdbSNP:372367350
263+c, tdbSNP:145945630
313+a, gdbSNP:142720069
378+dbSNP:
378+c, tdbSNP:74727182
383+g, tdbSNP:79323615
444+dbSNP:
444+g, tdbSNP:143145868
445+a, gdbSNP:375051600
469+c, tdbSNP:369238363
470+c, gdbSNP:201567345
477+c, tdbSNP:146221748
481+c, tdbSNP:376213437
488+c, tdbSNP:139196838
489+a, gdbSNP:199842850
504+a, cdbSNP:74953290
510+a, gdbSNP:201764637
534+c, gdbSNP:200117298
539+g, tdbSNP:142637152
540+a, gdbSNP:369999291
555+a, gdbSNP:193049694
572+a, gdbSNP:200089324
578+c, gdbSNP:376628500
581+a, gdbSNP:150973053
613+c, gdbSNP:202161017
642+dbSNP:
642+a, gdbSNP:371085910
643+a, gdbSNP:116020626
663+a, gdbSNP:137854576
702..705+, atagdbSNP:387906231
703+c, tdbSNP:111875298
730..731+dbSNP:
730..731+, cdbSNP:35790168
730+a, cdbSNP:149736402
757+a, gdbSNP:377493489
766+c, tdbSNP:185154886
774+a, gdbSNP:200740020
781+c, tdbSNP:147846364
800+c, gdbSNP:141576417
815+c, tdbSNP:137854583
836+c, tdbSNP:137854577
839+dbSNP:
839+c, tdbSNP:62619935
840+a, g, tdbSNP:76685252
865+c, tdbSNP:367816013
887+c, tdbSNP:397515734
888+a, gdbSNP:201727026
898+a, gdbSNP:147036141
923..924+dbSNP:
923..924+, agdbSNP:387906228
970+g, tdbSNP:147704593
984+a, gdbSNP:369345931
1032+dbSNP:
1032+c, gdbSNP:137854569
1041+a, gdbSNP:149154604
1047+a, gdbSNP:201093383
1055+a, cdbSNP:199535736
1087+c, gdbSNP:143341972
1089..1090+, ctdbSNP:397515735
1097+c, tdbSNP:137854568
1130..1131+dbSNP:
1130..1131+, gadbSNP:387906239
1186+a, gdbSNP:148343173
1188+a, gdbSNP:377665107
complement(1198)-t, cdbSNP:3797704
1214+a, cdbSNP:77058194
1262..1263+, adbSNP:387906232
1289+a, gdbSNP:199562537
1291..1292+, ctdbSNP:387906237
1305+a, gdbSNP:377351581
1307+a, gdbSNP:201478136
1314+a, gdbSNP:141582813
1351+a, gdbSNP:370669642
1385..1386+, aadbSNP:387906238
1386+a, gdbSNP:145912662
1433+c, tdbSNP:137854567
1467+a, gdbSNP:77907679
1469+g, tdbSNP:200598389
1492+a, gdbSNP:141726130
1524+dbSNP:
1524+a, gdbSNP:371065509
1535+c, gdbSNP:374195067
1562+, tdbSNP:387906229
1611+dbSNP:
1611+a, gdbSNP:190988940
1612+a, gdbSNP:141579422
1636+a, gdbSNP:146179851
1651+c, tdbSNP:2229992
1656+c, tdbSNP:368434773
1676+a, gdbSNP:372047677
1681+a, tdbSNP:9282599
1684+a, gdbSNP:201992951
1687+a, gdbSNP:199726985
1688+c, g, tdbSNP:137854580
1693+g, tdbSNP:387906230
1696+c, tdbSNP:201664378
1708+g, tdbSNP:77451514
1746+dbSNP:
1746+c, tdbSNP:371453363
1782+c, tdbSNP:202199891
1797+c, tdbSNP:75870842
1799+a, gdbSNP:138098808
1814+c, tdbSNP:137854572
1824+dbSNP:
1824+c, tdbSNP:144056494
1828+c, tdbSNP:386583324
1852+a, gdbSNP:398123116
1853+c, tdbSNP:137854573
1860+a, tdbSNP:111423620
1861+c, tdbSNP:377045570
1883+c, tdbSNP:137854574
1888+, adbSNP:397514032
1888+a, gdbSNP:77921116
1954+dbSNP:
1954+c, tdbSNP:370783137
1955+a, gdbSNP:372416031
2004+c, gdbSNP:370955311
2018+a, gdbSNP:147863331
2056+c, tdbSNP:72541808
2078..2079+, adbSNP:387906233
2101+g, tdbSNP:79015778
2105+a, gdbSNP:75117039
2110..2111+, adbSNP:397515732
2120+c, tdbSNP:78349383
2152+dbSNP:
2152+a, gdbSNP:72541809
2206+g, tdbSNP:145356265
2286+a, tdbSNP:137854582
2293+c, tdbSNP:376487701
2303+a, gdbSNP:367804502
2331+c, gdbSNP:137854570
2347+a, tdbSNP:372725652
2380+c, tdbSNP:376015279
2397+a, c, tdbSNP:147655929
2398+a, gdbSNP:141001261
2415+a, gdbSNP:150209825
2425+g, tdbSNP:145751759
2443+a, tdbSNP:376526724
2455+g, tdbSNP:148987776
2490+c, tdbSNP:200339830
2503+a, gdbSNP:201019009
2515+c, tdbSNP:145792879
2528+c, tdbSNP:369138788
2558+c, tdbSNP:398123117
2578+c, tdbSNP:80188155
2579+g, tdbSNP:77985571
2597+g, tdbSNP:79853077
2607+a, gdbSNP:200593940
2611+a, tdbSNP:372917037
2631+a, gdbSNP:201522866
2654+a, gdbSNP:138498551
2667+a, gdbSNP:186641437
2669+g, tdbSNP:145245264
2702+g, tdbSNP:79634147
2703+a, c, gdbSNP:79512956
2704+a, gdbSNP:79909810
2740..2743+, tagadbSNP:398123118
2779+c, gdbSNP:147972247
2786+c, tdbSNP:192620988
2793+a, cdbSNP:374813438
2801+c, tdbSNP:33974176
2806+a, cdbSNP:36046448
2819+c, tdbSNP:121913333
2820+a, gdbSNP:373428732
2833+c, tdbSNP:200184105
2870+a, gdbSNP:199740875
2924+g, tdbSNP:398123119
2957+c, tdbSNP:150543576
2971+c, tdbSNP:371526966
2998+a, c, tdbSNP:137854575
2998+, cdbSNP:398123120
3031+a, gdbSNP:142835322
3040+g, tdbSNP:147394539
3113+g, tdbSNP:74561014
3136+a, cdbSNP:148153867
3138+c, tdbSNP:139773221
3139+a, gdbSNP:377384463
3141+c, tdbSNP:113674464
3188+a, cdbSNP:75239284
3199+c, tdbSNP:72541810
3266+a, gdbSNP:370591349
3355+, cdbSNP:397515733
3358+a, tdbSNP:61734287
3366+a, gdbSNP:148725540
3392+c, tdbSNP:137854571
3398+a, gdbSNP:375408871
3425+c, tdbSNP:367687901
3435+a, gdbSNP:374380039
3442+g, tdbSNP:201629780
3444+a, gdbSNP:201904856
3457+a, gdbSNP:114774495
3472+g, tdbSNP:199539973
3501+a, gdbSNP:200371555
3516+a, gdbSNP:151286353
3528+a, cdbSNP:146007372
3533+c, tdbSNP:121913331
3545+a, gdbSNP:140493115
3552+a, gdbSNP:28933379
3558+a, gdbSNP:372855304
3567+c, tdbSNP:377278397
3571+c, gdbSNP:149353082
3579+c, tdbSNP:143638171
3608+a, cdbSNP:201550951
3618+a, gdbSNP:138410865
3619+a, tdbSNP:375478525
3629+c, tdbSNP:202168805
3638+a, gdbSNP:371117193
3661..3663+, agadbSNP:386833391
3664+a, gdbSNP:143927847
3667+a, tdbSNP:371597034
3672+a, cdbSNP:201004111
3704+c, tdbSNP:201830995
3705+a, gdbSNP:372481703
3722+a, gdbSNP:369834416
3777+c, tdbSNP:386833392
3801+a, gdbSNP:141444802
3818+a, gdbSNP:201185479
3821+c, tdbSNP:145181563
3843+a, cdbSNP:138933660
3846+c, tdbSNP:377640390
3880+c, tdbSNP:149045486
3883+c, gdbSNP:147268065
3923+a, cdbSNP:79122263
3925+a, gdbSNP:74380081
3932+a, gdbSNP:148223181
3943+a, g, tdbSNP:142728143
3959+a, cdbSNP:77056664
3974+a, gdbSNP:199792739
3979+c, tdbSNP:147411334
4068+c, tdbSNP:371113837
4069+a, gdbSNP:377494451
4109+g, tdbSNP:121913462
4113+a, tdbSNP:1801155
4120..4124+, aaagadbSNP:121913224
4126+c, tdbSNP:201706728
4142+c, gdbSNP:1801166
4156+c, tdbSNP:150595875
4175+c, tdbSNP:398123121
4205+c, tdbSNP:121913327
4265+a, gdbSNP:139618756
4267+a, gdbSNP:149782464
4280+a, gdbSNP:370711075
4281+a, gdbSNP:373607243
4282+a, gdbSNP:113274140
4292+c, tdbSNP:121913328
complement(4301)-t, gdbSNP:377860
4325+c, tdbSNP:121913329
4328+g, tdbSNP:121913326
4376+a, tdbSNP:137854578
4392+c, tdbSNP:267600319
4393+a, gdbSNP:367782881
4405+a, cdbSNP:144655979
4410+a, gdbSNP:372241082
4430+a, gdbSNP:141519952
4442+a, cdbSNP:200166878
4458+a, gdbSNP:368327191
4478+a, c, tdbSNP:74535574
4504+a, gdbSNP:371784771
4519+a, tdbSNP:67622085
4529+a, gdbSNP:146572883
4541+c, tdbSNP:121913332
4552+c, tdbSNP:369121091
4553+a, gdbSNP:111866410
4565+c, tdbSNP:143796828
4568..4570+, actdbSNP:386833393
4577+a, gdbSNP:202204285
4584..4587+, agagdbSNP:387906235
4584+a, gdbSNP:112961968
4585..4586+, gadbSNP:121913334
4586..4587+, agdbSNP:387906234
4613+a, gdbSNP:139387758
4617+c, tdbSNP:375380414
4666..4667+, tdbSNP:398123122
4671+c, tdbSNP:374892194
complement(4680)-g, cdbSNP:2229996
4726+c, tdbSNP:150089434
4764+c, tdbSNP:200803739
4804..4805+, agdbSNP:387906236
4811+c, gdbSNP:73220015
4816+a, gdbSNP:369281524
4879+c, tdbSNP:72541812
4881+c, tdbSNP:201675099
4902+a, gdbSNP:373419559
4903+c, tdbSNP:201764198
4925+g, tdbSNP:138367627
4935+c, gdbSNP:377169217
4958+c, gdbSNP:72541813
4959+a, gdbSNP:374048423
4960+c, tdbSNP:181255489
4978+c, gdbSNP:201287984
5046+c, tdbSNP:185411044
5047+a, gdbSNP:377666490
5086+c, tdbSNP:35634377
5094+c, tdbSNP:370433763
5098+a, gdbSNP:137988845
5106+c, tdbSNP:201797422
5111+c, tdbSNP:373440614
5185+c, tdbSNP:138743276
5202+c, tdbSNP:202228932
5219..5221+, agadbSNP:375262769
5219+a, gdbSNP:370560998
5220+c, gdbSNP:143674116
5227+a, gdbSNP:42427
5261+a, gdbSNP:201142277
5308+c, tdbSNP:373698193
5333+a, gdbSNP:148275069
5340+a, gdbSNP:141298709
5363+c, gdbSNP:201415309
5371+a, gdbSNP:368494571
5406+a, cdbSNP:149882057
5418+a, gdbSNP:199775075
5443+c, gdbSNP:2229997
5448+a, tdbSNP:139552305
5456+g, tdbSNP:371067258
5458+a, gdbSNP:34506289
5467+a, tdbSNP:199600387
5495+a, gdbSNP:199630012
5556+a, gdbSNP:201472075
5567+a, cdbSNP:74853403
5569+a, tdbSNP:76364845
5579+a, gdbSNP:367577259
5585+a, gdbSNP:200794097
5593+c, tdbSNP:376290290
5623+g, tdbSNP:149828124
5665+c, tdbSNP:200742564
5708+g, tdbSNP:75236689
5714+g, tdbSNP:76306073
5721+c, tdbSNP:368080169
5733+c, tdbSNP:371686531
5764+a, cdbSNP:376624613
5766+a, gdbSNP:369831474
5838+c, gdbSNP:34157245
5878+c, gdbSNP:148592182
5883+a, cdbSNP:112610898
5895+a, cdbSNP:72541814
5932+, tdbSNP:142194865
5934+c, gdbSNP:199904481
5938+c, gdbSNP:201988789
5949+a, gdbSNP:147740612
5983+a, gdbSNP:141152252
5998+a, gdbSNP:377040690
6070+g, tdbSNP:369899251
6100+c, gdbSNP:200881543
6111+c, gdbSNP:4987109
6132+a, gdbSNP:180727920
6133+a, cdbSNP:147598747
6135+, adbSNP:397509433
6145+c, tdbSNP:142019870
6175+c, gdbSNP:372852823
6233+a, gdbSNP:143313902
6292+c, gdbSNP:370532497
6310+g, tdbSNP:372418435
6324+a, gdbSNP:375743017
6328+c, tdbSNP:187297940
6366+a, gdbSNP:150140908
6375+a, cdbSNP:370984580
6387+c, tdbSNP:112487226
6442+a, gdbSNP:374625279
6466+c, tdbSNP:368356944
6559+a, tdbSNP:370948574
6566+a, tdbSNP:371097044
6580+a, gdbSNP:374310157
6703+a, cdbSNP:138571760
6715+c, tdbSNP:370781162
6718+a, gdbSNP:200151646
6719+c, tdbSNP:183468041
6728+a, gdbSNP:376096304
6753+a, gdbSNP:146695342
6802+c, tdbSNP:149328018
6827+g, tdbSNP:200682225
6830+a, gdbSNP:186926737
6832+c, tdbSNP:35540155
6851+a, gdbSNP:374464049
6858+c, tdbSNP:367761032
6862+a, gdbSNP:372680843
6863+a, gdbSNP:374597207
6872+g, tdbSNP:367905430
6875+a, gdbSNP:199648202
6917+a, gdbSNP:201375478
6975+c, tdbSNP:376494248
6989..6990+, cdbSNP:375894927
7014+a, gdbSNP:34919187
7044+c, tdbSNP:200468360
7050+c, tdbSNP:200587641
7066+a, tdbSNP:148878262
7093+c, tdbSNP:202012533
7114+a, gdbSNP:2229993
7141+a, gdbSNP:202144406
7178+a, gdbSNP:146048493
7229+c, tdbSNP:200756935
7242+a, c, tdbSNP:75207119
7243+a, cdbSNP:78556145
7245..7246+, cdbSNP:35817266
7298+c, tdbSNP:377308875
7302+g, tdbSNP:140079759
7330+c, gdbSNP:141454910
7386+c, tdbSNP:150882838
7394+c, tdbSNP:2229994
7417+c, tdbSNP:150029348
7588+c, tdbSNP:369906346
7592+a, cdbSNP:372305287
7595+g, tdbSNP:375586273
7608+c, tdbSNP:200399245
7628+a, gdbSNP:369365383
7636+a, tdbSNP:147757080
7664+a, gdbSNP:375674083
7665+c, tdbSNP:369075403
7683+c, tdbSNP:141010008
7688+c, gdbSNP:33941929
7691+c, gdbSNP:372535376
7697+a, gdbSNP:2229995
7706+c, gdbSNP:79630786
7707+a, gdbSNP:147549623
7724+c, tdbSNP:72541815
7757+a, cdbSNP:371149405
7760+g, tdbSNP:4705693
7763+a, gdbSNP:143060722
7787+c, tdbSNP:375080917
7818+a, gdbSNP:151163793
7838+c, tdbSNP:199539353
7839+a, gdbSNP:199558585
7856+a, tdbSNP:370581125
7897+c, tdbSNP:35043160
7910+a, gdbSNP:145444830
7950+g, tdbSNP:199806334
complement(7951)-t, adbSNP:75459601
7959+a, gdbSNP:200406572
7965+a, cdbSNP:375393416
7971+a, gdbSNP:367676584
7979+g, tdbSNP:138137162
8006+c, gdbSNP:201625142
8055+c, gdbSNP:72541816
8058+c, tdbSNP:267600320
8081+a, gdbSNP:199688874
8122+a, gdbSNP:138796072
8136+a, cdbSNP:113486158
8158+g, tdbSNP:1803566
8166+g, tdbSNP:79619757
8196+a, gdbSNP:374886362
8235+c, tdbSNP:182456139
8236+c, gdbSNP:149347068
8253+c, tdbSNP:144746572
8261+a, gdbSNP:140868933
8279+g, tdbSNP:368724873
8323+g, tdbSNP:78176192
8327+c, tdbSNP:76933416
8330+a, cdbSNP:80277939
8392+a, gdbSNP:372365378
8396+a, gdbSNP:376392084
8454+a, gdbSNP:369721828
8459+a, gdbSNP:146115809
8466+a, gdbSNP:371616945
8503+c, gdbSNP:200160084
8571+a, gdbSNP:374853436
8576+a, gdbSNP:369264968
8582+a, gdbSNP:147287751
8592+c, tdbSNP:141024271
8652+c, tdbSNP:200790804
8690+c, gdbSNP:201459013
8757+a, gdbSNP:201206901
8811+a, cdbSNP:1804197
8859+a, c, gdbSNP:76439767
8860+g, tdbSNP:79414727
8862+a, gdbSNP:75440329
8867+c, tdbSNP:6875894
8878+c, gdbSNP:374304258
8973+a, gdbSNP:186777258
8991+a, cdbSNP:191347307
9048+a, gdbSNP:1049291
9056+a, cdbSNP:182711327
9094..9095+, cdbSNP:34867143
9105+c, tdbSNP:62364045
9130..9131+, adbSNP:11432316
9130+a, cdbSNP:79379053
9139..9140+, adbSNP:397817775
9140+a, tdbSNP:200721845
9141+g, tdbSNP:201672843
9142+g, tdbSNP:199854946
9159+c, tdbSNP:12189
9192+a, gdbSNP:74503138
9323+a, cdbSNP:372443882
9359+a, cdbSNP:75495374
9380+g, tdbSNP:114463799
9458+a, gdbSNP:376702694
9478+g, tdbSNP:376855586
9530+a, cdbSNP:75717494
9622..9623+, gdbSNP:34794408
9714+c, tdbSNP:188796337
9765+c, tdbSNP:138328454
9775+c, tdbSNP:17135042
9820+, tdbSNP:35141360
9823+c, tdbSNP:41116
9838+a, gdbSNP:371250804
complement(9840)-g, adbSNP:11558346
9928+a, cdbSNP:6594650
10029+a, gdbSNP:112588804
10045+a, tdbSNP:373883680
10222+c, tdbSNP:138754620
10260+g, tdbSNP:76017392
10450+a, tdbSNP:372708871
10478+a, gdbSNP:397768
10490+, tdbSNP:35060388
10493+a, gdbSNP:149405573
10543+a, gdbSNP:193216000
10643+c, gdbSNP:185342287
10702+c, tdbSNP:1049320
10815+a, cdbSNP:78525333
10836+a, gdbSNP:144766994
Gene SymbolAPC
Gene SynonymBTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Chromosome5
Locus Map5q21-q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001127510 Homo sapiens adenomatous polyposis coli (APC), transcript variant 2, mRNA. On-demand $4749.00 40
NM_001127511 Homo sapiens adenomatous polyposis coli (APC), transcript variant 1, mRNA. On-demand $4749.00 40
NM_000038 Homo sapiens adenomatous polyposis coli (APC), transcript variant 3, mRNA. On-demand $4749.00 40
Title Physiological expression of the PI3K-activating mutation Pik3ca(H1047R) combines with Apc loss to promote development of invasive intestinal adenocarcinomas in mice .
Author Hare LM, Phesse TJ, Waring PM, Montgomery KG, Kinross KM, Mills K, Roh V, Heath JK, Ramsay RG, Ernst M and Phillips WA.
Journal Biochem. J. 458 (2), 251-258 (2014)
Title Adenomatous polyposis coli gene involvement in ileal enterochromaffin cell neuroendocrine neoplasms .
Author Bottarelli L, Azzoni C, Pizzi S, D'Adda T, Silini EM, Bordi C and Rindi G.
Journal Hum. Pathol. 44 (12), 2736-2742 (2013)
Title Ultrasensitive detection of unknown colon cancer-initiating mutations using the example of the Adenomatous polyposis coli gene .
Author Gerecke C, Mascher C, Gottschalk U, Kleuser B and Scholtka B.
Journal Cancer Prev Res (Phila) 6 (9), 898-907 (2013)
Title Identification of an alternative 5' untranslated region of the adenomatous polyposis coli gene .
Author Lambertz S and Ballhausen WG.
Journal Hum. Genet. 90 (6), 650-652 (1993)
Title APC-Associated Polyposis Conditions .
Author Jasperson,K.W. and Burt,R.W.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Somatic mutation of the APC gene in gastric cancer: frequent mutations in very well differentiated adenocarcinoma and signet-ring cell carcinoma .
Author Nakatsuru S, Yanagisawa A, Ichii S, Tahara E, Kato Y, Nakamura Y and Horii A.
Journal Hum. Mol. Genet. 1 (8), 559-563 (1992)
Title Disruption of the APC gene by a retrotransposal insertion of L1 sequence in a colon cancer .
Author Miki Y, Nishisho I, Horii A, Miyoshi Y, Utsunomiya J, Kinzler KW, Vogelstein B and Nakamura Y.
Journal Cancer Res. 52 (3), 643-645 (1992)
Title Screening for germ-line mutations in familial adenomatous polyposis patients: 61 new patients and a summary of 150 unrelated patients .
Author Nagase H, Miyoshi Y, Horii A, Aoki T, Petersen GM, Vogelstein B, Maher E, Ogawa M, Maruyama M and Utsunomiya J.
Journal Hum. Mutat. 1 (6), 467-473 (1992)
Title Mutations of chromosome 5q21 genes in FAP and colorectal cancer patients .
Author Nishisho I, Nakamura Y, Miyoshi Y, Miki Y, Ando H, Horii A, Koyama K, Utsunomiya J, Baba S and Hedge P.
Journal Science 253 (5020), 665-669 (1991)
Title Identification of FAP locus genes from chromosome 5q21 .
Author Kinzler KW, Nilbert MC, Su LK, Vogelstein B, Bryan TM, Levy DB, Smith KJ, Preisinger AC, Hedge P and McKechnie D.
Journal Science 253 (5020), 661-665 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.