• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens AE binding protein 1 (AEBP1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001129 Homo sapiens AE binding protein 1 (AEBP1), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_001129.4, 495528518
Length 4102 bp
Structure linear
Update Date 13-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens AE binding protein 1 (AEBP1), mRNA.
Product adipocyte enhancer-binding protein 1 precursor
Comment

Summary: This gene encodes a member of carboxypeptidase A protein family. The encoded protein may function as a transcriptional repressor and play a role in adipogenesis and smooth muscle cell differentiation. Studies in mice suggest that this gene functions in wound healing and abdominal wall development. Overexpression of this gene is associated with glioblastoma. [provided by RefSeq, May 2013].

RefSeq NP_001120.3
CDS 306..3782
Misc Feature(1)261..263
Misc Feature(2)1461..1922
Misc Feature(3)1473..1970
Misc Feature(4)1566..2177
Misc Feature(5)order(1605..1607,1689..1691,1710..1712)
Misc Feature(6)1968..3260
Misc Feature(7)1983..3014
Misc Feature(8)order(2178..2180,2187..2189,2373..2375,2400..2405,
Misc Feature(9)order(2178..2180,2187..2189,2592..2594)
Misc Feature(10)3024..3251
Misc Feature(11)3126..3779
Misc Feature(12)3321..3779
Exon (1)1..558
Gene:AEBP1
Gene Synonym:ACLP
Exon (2)559..900
Gene:AEBP1
Gene Synonym:ACLP
Exon (3)901..972
Gene:AEBP1
Gene Synonym:ACLP
Exon (4)973..1044
Gene:AEBP1
Gene Synonym:ACLP
Exon (5)1045..1167
Gene:AEBP1
Gene Synonym:ACLP
Exon (6)1168..1245
Gene:AEBP1
Gene Synonym:ACLP
Exon (7)1246..1323
Gene:AEBP1
Gene Synonym:ACLP
Exon (8)1324..1401
Gene:AEBP1
Gene Synonym:ACLP
Exon (9)1402..1455
Gene:AEBP1
Gene Synonym:ACLP
Exon (10)1456..1565
Gene:AEBP1
Gene Synonym:ACLP
Exon (11)1566..1705
Gene:AEBP1
Gene Synonym:ACLP
Exon (12)1706..1790
Gene:AEBP1
Gene Synonym:ACLP
Exon (13)1791..1935
Gene:AEBP1
Gene Synonym:ACLP
Exon (14)1936..2021
Gene:AEBP1
Gene Synonym:ACLP
Exon (15)2022..2145
Gene:AEBP1
Gene Synonym:ACLP
Exon (16)2146..2342
Gene:AEBP1
Gene Synonym:ACLP
Exon (17)2343..2522
Gene:AEBP1
Gene Synonym:ACLP
Exon (18)2523..2874
Gene:AEBP1
Gene Synonym:ACLP
Exon (19)2875..3014
Gene:AEBP1
Gene Synonym:ACLP
Exon (20)3015..3114
Gene:AEBP1
Gene Synonym:ACLP
Exon (21)3115..4086
Gene:AEBP1
Gene Synonym:ACLP
Translation MAAVRGAPLLSCLLALLALCPGGRPQTVLTDDEIEEFLEGFLSELEPEPREDDVEAPPPP EPTPRVRKAQAGGKPGKRPGTAAEVPPEKTKDKGKKGKKDKGPKVPKESLEGSPRPPKKG KEKPPKATKKPKEKPPKATKKPKEKPPKATKKPKEKPPKATKKPPSGKRPPILAPSETLE WPLPPPPSPGPEELPQEGGAPLSNNWQNPGEETHVEAREHQPEPEEETEQPTLDYNDQIE REDYEDFEYIRRQKQPRPPPSRRRRPERVWPEPPEEKAPAPAPEERIEPPVKPLLPPLPP DYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEK GKDHKEPRKGEELEEEWTPTEKVKCPPIGMESHRIEDNQIRASSMLRHGLGAQRGRLNMQ TGATEDDYYDGAWCAEDDARTQWIEVDTRRTTRFTGVITQGRDSSIHDDFVTTFFVGFSN DSQTWVMYTNGYEEMTFHGNVDKDTPVLSELPEPVVARFIRIYPLTWNGSLCMRLEVLGC SVAPVYSYYAQNEVVATDDLDFRHHSYKDMRQLMKVVNEECPTITRTYSLGKSSRGLKIY AMEISDNPGEHELGEPEFRYTAGIHGNEVLGRELLLLLMQYLCREYRDGNPRVRSLVQDT RIHLVPSLNPDGYEVAAQMGSEFGNWALGLWTEEGFDIFEDFPDLNSVLWGAEERKWVPY RVPNNNLPIPERYLSPDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVSYPYDMARTPT QEQLLAAAMAAARGEDEDEVSEAQETPDHAIFRWLAISFASAHLTLTEPYRGGCQAQDYT GGMGIVNGAKWNPRTGTINDFSYLHTNCLELSFYLGCDKFPHESELPREWENNKEALLTF MEQVHRGIKGVVTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGY TPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTPQQRRLQQ RRLQHRLRLRAQMRLRRLNATTTLGPHTVPPTLPPAPATTLSTTIEPWGLIPPTTAGWEE SETETYTEVVTEFGTEVEPEFGTKVEPEFETQLEPEFETQLEPEFEEEEEEEKEEEIATG QAFPFTTVETYTVNFGDF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
134+dbSNP:
134+a, cdbSNP:187131829
172+a, cdbSNP:375810199
242+c, gdbSNP:28362520
325+a, cdbSNP:28362521
367+c, tdbSNP:13241299
387+a, gdbSNP:375195748
428+c, tdbSNP:201978706
448+a, gdbSNP:141126404
518+, gdbSNP:112298043
565+dbSNP:
565+c, tdbSNP:75107445
572+c, gdbSNP:139078339
579+c, gdbSNP:371412622
616+a, gdbSNP:145109144
640+a, gdbSNP:375250739
653+a, gdbSNP:201227189
689+c, gdbSNP:200224104
701+a, gdbSNP:199689593
770+a, gdbSNP:201151753
786+a, tdbSNP:112053839
794+a, gdbSNP:201982646
799+c, tdbSNP:140913379
800+a, gdbSNP:144974496
812+a, gdbSNP:200698594
865+c, gdbSNP:200193837
878+c, tdbSNP:376847554
879+a, gdbSNP:368973524
904+dbSNP:
904+c, tdbSNP:139352566
907+c, gdbSNP:369661351
932..933+, adbSNP:34982915
975+dbSNP:
975+c, gdbSNP:200342317
983+c, gdbSNP:367737639
989+c, tdbSNP:148932183
1005+g, tdbSNP:372015098
1016+a, cdbSNP:375315010
1017+a, cdbSNP:142763648
1028+c, gdbSNP:151068311
1038+a, gdbSNP:201963190
1044+c, tdbSNP:141311453
1058+dbSNP:
1058+a, gdbSNP:145045450
1060+a, gdbSNP:200279382
1103+c, tdbSNP:368747482
complement(1122)-t, gdbSNP:2537188
1157+a, gdbSNP:374676651
1193+dbSNP:
1193+c, tdbSNP:144144167
1196+a, gdbSNP:200809130
1200+c, tdbSNP:376019197
1210+a, gdbSNP:376262022
1224+a, gdbSNP:138067786
1225+g, tdbSNP:369540170
1255+dbSNP:
1255+a, gdbSNP:376785882
1270+c, tdbSNP:141003956
1271+a, gdbSNP:371155958
1294+g, tdbSNP:374505155
complement(1301)-t, cdbSNP:2595701
1304+c, tdbSNP:138623215
1305+a, gdbSNP:149248982
1310+g, tdbSNP:377324824
1346+dbSNP:
1346+c, gdbSNP:199942462
1408+dbSNP:
1408+a, gdbSNP:75175945
1413+a, gdbSNP:200190216
1439+a, gdbSNP:376053706
1446+c, gdbSNP:202186949
1480+dbSNP:
1480+c, tdbSNP:144457398
1486+a, gdbSNP:111888664
1535+a, gdbSNP:376044473
1537+c, gdbSNP:376270715
1545+c, tdbSNP:137891711
1552+a, gdbSNP:368135596
1568+dbSNP:
1568+c, tdbSNP:369588798
1584+g, tdbSNP:373830686
1594+a, gdbSNP:143568325
1601+a, gdbSNP:372850520
1611+a, gdbSNP:376165441
1629+c, gdbSNP:370857030
1635+a, tdbSNP:61737461
1640+a, gdbSNP:140926602
1655+a, gdbSNP:375790313
1663+a, gdbSNP:144784842
1687+a, gdbSNP:199564337
1710+dbSNP:
1710+a, gdbSNP:150909656
1723+c, gdbSNP:139397017
1769+c, tdbSNP:192685042
1781+g, tdbSNP:199596276
1799+dbSNP:
1799+a, tdbSNP:376721512
1805+c, tdbSNP:201501212
1813+a, gdbSNP:150055229
1818+a, gdbSNP:370022508
1824+a, gdbSNP:372825522
1831+a, gdbSNP:374647057
1846+c, tdbSNP:200076938
1880+c, gdbSNP:75738447
1905+c, tdbSNP:141206792
1938+dbSNP:
1938+a, c, gdbSNP:143744776
1952+c, tdbSNP:146802668
1953+a, gdbSNP:376114999
1976+c, tdbSNP:141019167
1977+a, gdbSNP:143113716
1992+c, tdbSNP:199515795
2001+a, gdbSNP:148240925
2013+a, gdbSNP:140411744
2017+a, gdbSNP:200867650
2021+c, gdbSNP:200212819
2024+dbSNP:
2024+c, tdbSNP:150374163
2031+a, gdbSNP:368488702
2034+a, gdbSNP:200666867
2101+g, tdbSNP:137956957
2161+dbSNP:
2161+a, gdbSNP:143372513
2162+c, tdbSNP:368996866
2236+g, tdbSNP:375474488
2249+a, tdbSNP:11770649
2281+a, tdbSNP:374944511
2292+a, cdbSNP:199581509
2307+c, tdbSNP:369402824
2315+g, tdbSNP:373373055
2324+c, gdbSNP:181697573
2325+a, gdbSNP:184719396
2363+dbSNP:
2363+c, gdbSNP:201455144
2422+a, tdbSNP:200174513
2455+c, gdbSNP:374341905
2476+a, gdbSNP:377753845
2499+c, tdbSNP:145884426
2539+dbSNP:
2539+c, gdbSNP:138705367
2594+c, tdbSNP:149410697
2597+c, tdbSNP:370216167
2601+c, gdbSNP:201912634
2627+c, tdbSNP:201492258
2632+c, tdbSNP:144799697
2668+c, tdbSNP:200626782
2683+c, gdbSNP:374013273
2684+g, tdbSNP:142028646
2690+a, gdbSNP:377008639
2694+c, gdbSNP:150691639
2748+c, gdbSNP:140025413
2790+a, cdbSNP:143544464
2841+a, gdbSNP:200145109
2866+g, tdbSNP:201478823
2870+a, cdbSNP:146820958
2888+dbSNP:
2888+a, cdbSNP:139591184
2894+c, tdbSNP:150005580
2895+a, cdbSNP:200012664
2909+c, tdbSNP:145586647
3064+dbSNP:
3064+c, tdbSNP:200487092
3143+dbSNP:
3143+g, tdbSNP:75837861
3155+a, gdbSNP:201507217
3161+c, tdbSNP:148876034
3190+c, tdbSNP:143605377
3218+a, tdbSNP:372595583
3244+c, tdbSNP:367704352
3248+c, tdbSNP:147631109
3257+c, tdbSNP:141977965
3278+a, gdbSNP:371157380
3298+a, gdbSNP:200154504
3307+c, tdbSNP:4724285
3349+a, tdbSNP:200791707
3396+a, gdbSNP:146344486
3412+a, gdbSNP:200356275
3430+c, tdbSNP:376181075
3452+c, gdbSNP:202072841
3467+c, tdbSNP:113676804
3502+a, gdbSNP:201065802
3536+c, gdbSNP:61736256
3540+a, gdbSNP:138297087
3559+c, tdbSNP:149601977
3641+a, gdbSNP:148505735
3694+a, gdbSNP:199622819
3695+a, gdbSNP:142895757
3702+a, gdbSNP:13928
3737..3738+, cdbSNP:34841625
3747+a, gdbSNP:13898
3770+c, tdbSNP:113791881
3789+c, tdbSNP:369527737
complement(3790)-t, cdbSNP:3217972
3790+a, gdbSNP:386581073
3828+c, tdbSNP:377231955
3883+c, tdbSNP:113592869
3987+a, cdbSNP:1054302
4004+a, gdbSNP:1054306
4011+a, cdbSNP:3217971
4011+g, tdbSNP:386581072
4021+a, gdbSNP:11769874
4084+c, gdbSNP:372644553
Gene SymbolAEBP1
Gene SynonymACLP
Chromosome7
Locus Map7p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001129 Homo sapiens AE binding protein 1 (AEBP1), mRNA. On-demand TBD TBD
Title Aortic carboxypeptidase-like protein (ACLP) enhances lung myofibroblast differentiation through transforming growth factor beta receptor-dependent and -independent pathways .
Author Tumelty KE, Smith BD, Nugent MA and Layne MD.
Journal J. Biol. Chem. 289 (5), 2526-2536 (2014)
Title Berberine-induced inhibition of adipocyte enhancer-binding protein 1 attenuates oxidized low-density lipoprotein accumulation and foam cell formation in phorbol 12-myristate 13-acetate-induced macrophages .
Author Huang Z, Dong F, Li S, Chu M, Zhou H, Lu Z and Huang W.
Journal Eur. J. Pharmacol. 690 (1-3), 164-169 (2012)
Title AEBP1 gene variants in infants with gastroschisis .
Author Feldkamp ML, Bowles NE and Botto LD.
Journal Birth Defects Res. Part A Clin. Mol. Teratol. 94 (9), 738-742 (2012)
Title Identification of genomic targets of transcription factor AEBP1 and its role in survival of glioma cells .
Author Ladha J, Sinha S, Bhat V, Donakonda S and Rao SM.
Journal Mol. Cancer Res. 10 (8), 1039-1051 (2012)
Title PPARgamma1 and LXRalpha face a new regulator of macrophage cholesterol homeostasis and inflammatory responsiveness, AEBP1 .
Author Majdalawieh A and Ro HS.
Journal Nucl Recept Signal 8, E004 (2010)
Title Impaired abdominal wall development and deficient wound healing in mice lacking aortic carboxypeptidase-like protein .
Author Layne MD, Yet SF, Maemura K, Hsieh CM, Bernfield M, Perrella MA and Lee ME.
Journal Mol. Cell. Biol. 21 (15), 5256-5261 (2001)
Title Enzymic characterization of a novel member of the regulatory B-like carboxypeptidase with transcriptional repression function: stimulation of enzymic activity by its target DNA .
Author Muise AM and Ro HS.
Journal Biochem. J. 343 (PT 2), 341-345 (1999)
Title Aortic carboxypeptidase-like protein, a novel protein with discoidin and carboxypeptidase-like domains, is up-regulated during vascular smooth muscle cell differentiation .
Author Layne MD, Endege WO, Jain MK, Yet SF, Hsieh CM, Chin MT, Perrella MA, Blanar MA, Haber E and Lee ME.
Journal J. Biol. Chem. 273 (25), 15654-15660 (1998)
Title Cloning and expression of human carboxypeptidase Z, a novel metallocarboxypeptidase .
Author Song L and Fricker LD.
Journal J. Biol. Chem. 272 (16), 10543-10550 (1997)
Title A cDNA cloning of human AEBP1 from primary cultured osteoblasts and its expression in a differentiating osteoblastic cell line .
Author Ohno I, Hashimoto J, Shimizu K, Takaoka K, Ochi T, Matsubara K and Okubo K.
Journal Biochem. Biophys. Res. Commun. 228 (2), 411-414 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.