Sequence in raw or FASTA format:
Homo sapiens AE binding protein 1 (AEBP1), mRNA.
| RefSeq Version | NM_001129.3, 53692188 |
| Length | 4125 bp |
| Structure | linear |
| Update Date | 10-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens AE binding protein 1 (AEBP1), mRNA. |
| Product | adipocyte enhancer-binding protein 1 precursor |
| Comment | Summary: The adipocyte enhancer binding protein 1 is a transcriptional repressor with carboxypeptidase (CP) activity. This protein binds to a regulatory sequence, adipocyte enhancer 1 (AE-1), located in the proximal promoter region of the adipose P2 (aP2) gene, which encodes the adipocyte fatty-acid binding protein. It is characterized as a member of the regulatory B-like CP family. This protein seems to be activated by a novel mechanism, whereby the direct binding of DNA enhances its protease activity. Adipocyte-enhancer binding protein 1 may play a role in differentiated vascular smooth muscle cells. [provided by RefSeq]. COMPLETENESS: complete on the 3' end. |
| RefSeq | NP_001120.3 |
| CDS | 306..3782 | Exon (1) | 1..558 | Exon (2) | 1..558 | Exon (3) | 559..900 | Exon (4) | 901..972 | Exon (5) | 973..1044 | Exon (6) | 1045..1167 | Exon (7) | 1168..1245 | Exon (8) | 1246..1323 | Exon (9) | 1324..1401 | Exon (10) | 1402..1455 | Exon (11) | 1456..1565 | Exon (12) | 1566..1705 | Exon (13) | 1706..1790 | Exon (14) | 1791..1935 | Exon (15) | 1936..2021 | Exon (16) | 2022..2145 | Exon (17) | 2146..2342 | Exon (18) | 2343..2522 | Exon (19) | 2523..2874 | Exon (20) | 2875..3014 | Exon (21) | 3015..3114 | Exon (22) | 3115..4081 |
| Translation | MAAVRGAPLLSCLLALLALCPGGRPQTVLTDDEIEEFLEGFLSELEPEPREDDVEAPPPP
EPTPRVRKAQAGGKPGKRPGTAAEVPPEKTKDKGKKGKKDKGPKVPKESLEGSPRPPKKG
KEKPPKATKKPKEKPPKATKKPKEKPPKATKKPKEKPPKATKKPPSGKRPPILAPSETLE
WPLPPPPSPGPEELPQEGGAPLSNNWQNPGEETHVEAREHQPEPEEETEQPTLDYNDQIE
REDYEDFEYIRRQKQPRPPPSRRRRPERVWPEPPEEKAPAPAPEERIEPPVKPLLPPLPP
DYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEK
GKDHKEPRKGEELEEEWTPTEKVKCPPIGMESHRIEDNQIRASSMLRHGLGAQRGRLNMQ
TGATEDDYYDGAWCAEDDARTQWIEVDTRRTTRFTGVITQGRDSSIHDDFVTTFFVGFSN
DSQTWVMYTNGYEEMTFHGNVDKDTPVLSELPEPVVARFIRIYPLTWNGSLCMRLEVLGC
SVAPVYSYYAQNEVVATDDLDFRHHSYKDMRQLMKVVNEECPTITRTYSLGKSSRGLKIY
AMEISDNPGEHELGEPEFRYTAGIHGNEVLGRELLLLLMQYLCREYRDGNPRVRSLVQDT
RIHLVPSLNPDGYEVAAQMGSEFGNWALGLWTEEGFDIFEDFPDLNSVLWGAEERKWVPY
RVPNNNLPIPERYLSPDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVSYPYDMARTPT
QEQLLAAAMAAARGEDEDEVSEAQETPDHAIFRWLAISFASAHLTLTEPYRGGCQAQDYT
GGMGIVNGAKWNPRTGTINDFSYLHTNCLELSFYLGCDKFPHESELPREWENNKEALLTF
MEQVHRGIKGVVTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGY
TPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTPQQRRLQQ
RRLQHRLRLRAQMRLRRLNATTTLGPHTVPPTLPPAPATTLSTTIEPWGLIPPTTAGWEE
SETETYTEVVTEFGTEVEPEFGTKVEPEFETQLEPEFETQLEPEFEEEEEEEKEEEIATG
QAFPFTTVETYTVNFGDF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 242 | + | c, g | dbSNP:28362520 |
| 325 | + | a, c | dbSNP:28362521 |
| 367 | + | c, t | dbSNP:13241299 |
| 518 | + | , g | dbSNP:112298043 |
| 565 | + | c, t | dbSNP:75107445 |
| 786 | + | a, t | dbSNP:112053839 |
| 901 | + | , largedeletion | dbSNP:71699199 |
| 932..933 | + | , a | dbSNP:34982915 |
| complement(1122) | - | t, g | dbSNP:2537188 |
| complement(1301) | - | t, c | dbSNP:2595701 |
| 1323 | + | , largedeletion | dbSNP:71643338 |
| 1408 | + | a, g | dbSNP:75175945 |
| 1486 | + | a, g | dbSNP:111888664 |
| 1635 | + | a, t | dbSNP:61737461 |
| 1880 | + | c, g | dbSNP:75738447 |
| 2249 | + | a, t | dbSNP:11770649 |
| 3143 | + | g, t | dbSNP:75837861 |
| 3307 | + | c, t | dbSNP:4724285 |
| 3467 | + | c, t | dbSNP:113676804 |
| 3536 | + | c, g | dbSNP:61736256 |
| 3702 | + | a, g | dbSNP:13928 |
| 3737..3738 | + | , c | dbSNP:34841625 |
| 3747 | + | a, g | dbSNP:13898 |
| 3770 | + | c, t | dbSNP:113791881 |
| complement(3790) | - | t, c | dbSNP:3217972 |
| 3883 | + | c, t | dbSNP:113592869 |
| 3987 | + | a, c | dbSNP:1054302 |
| 4004 | + | a, g | dbSNP:1054306 |
| complement(4011) | - | c, a | dbSNP:3217971 |
| 4021 | + | a, g | dbSNP:11769874 |
| Title | PPARgamma1 and LXRalpha face a new regulator of macrophage cholesterol homeostasis and inflammatory responsiveness, AEBP1 . |
| Author | Majdalawieh,A. and Ro,H.S. |
| Journal | Nucl Recept Signal 8, E004 (2010) |
| Title | Aortic carboxypeptidase-like protein is expressed in fibrotic human lung and its absence protects against bleomycin-induced lung fibrosis . |
| Author | Schissel,S.L., Dunsmore,S.E., Liu,X., Shine,R.W., Perrella,M.A. and Layne,M.D. |
| Journal | Am. J. Pathol. 174 (3), 818-828 (2009) |
| Title | The role of AEBP1 in sex-specific diet-induced obesity . |
| Author | Zhang,L., Reidy,S.P., Nicholson,T.E., Lee,H.J., Majdalawieh,A., Webber,C., Stewart,B.R., Dolphin,P. and Ro,H.S. |
| Journal | Mol. Med. 11 (1-12), 39-47 (2005) |
| Title | Impaired abdominal wall development and deficient wound healing in mice lacking aortic carboxypeptidase-like protein . |
| Author | Layne,M.D., Yet,S.F., Maemura,K., Hsieh,C.M., Bernfield,M., Perrella,M.A. and Lee,M.E. |
| Journal | Mol. Cell. Biol. 21 (15), 5256-5261 (2001) |
| Title | Enzymic characterization of a novel member of the regulatory B-like carboxypeptidase with transcriptional repression function: stimulation of enzymic activity by its target DNA . |
| Author | Muise,A.M. and Ro,H.S. |
| Journal | Biochem. J. 343 PT 2, 341-345 (1999) |
| Title | Aortic carboxypeptidase-like protein, a novel protein with discoidin and carboxypeptidase-like domains, is up-regulated during vascular smooth muscle cell differentiation . |
| Author | Layne,M.D., Endege,W.O., Jain,M.K., Yet,S.F., Hsieh,C.M., Chin,M.T., Perrella,M.A., Blanar,M.A., Haber,E. and Lee,M.E. |
| Journal | J. Biol. Chem. 273 (25), 15654-15660 (1998) |
| Title | A cDNA cloning of human AEBP1 from primary cultured osteoblasts and its expression in a differentiating osteoblastic cell line . |
| Author | Ohno,I., Hashimoto,J., Shimizu,K., Takaoka,K., Ochi,T., Matsubara,K. and Okubo,K. |
| Journal | Biochem. Biophys. Res. Commun. 228 (2), 411-414 (1996) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |