• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens AE binding protein 1 (AEBP1), mRNA.


RefSeq Accession Definition Services Price Order
NM_001129 Homo sapiens AE binding protein 1 (AEBP1), mRNA. ORF Sequence $1216.95
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001129.3, 53692188
Length 4125 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens AE binding protein 1 (AEBP1), mRNA.
Product adipocyte enhancer-binding protein 1 precursor
Comment

Summary: The adipocyte enhancer binding protein 1 is a transcriptional repressor with carboxypeptidase (CP) activity. This protein binds to a regulatory sequence, adipocyte enhancer 1 (AE-1), located in the proximal promoter region of the adipose P2 (aP2) gene, which encodes the adipocyte fatty-acid binding protein. It is characterized as a member of the regulatory B-like CP family. This protein seems to be activated by a novel mechanism, whereby the direct binding of DNA enhances its protease activity. Adipocyte-enhancer binding protein 1 may play a role in differentiated vascular smooth muscle cells. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BC038588.1, AB209744.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_001120.3
CDS 306..3782
Misc Feature(1)261..263
Misc Feature(2)1461..1922
Misc Feature(3)1464..1925
Misc Feature(4)1473..1970
Misc Feature(5)1566..2177
Misc Feature(6)order(1605..1607,1689..1691,1710..1712)
Misc Feature(7)1968..3260
Misc Feature(8)1983..3014
Misc Feature(9)order(2178..2180,2187..2189,2373..2375,2400..2405,
Misc Feature(10)order(2178..2180,2187..2189,2592..2594)
Misc Feature(11)3024..3251
Misc Feature(12)3126..3779
Misc Feature(13)3321..3779
Exon (1)1..558
Gene:AEBP1
Gene Synonym:ACLP
Exon (2)559..900
Gene:AEBP1
Gene Synonym:ACLP
Exon (3)901..972
Gene:AEBP1
Gene Synonym:ACLP
Exon (4)973..1044
Gene:AEBP1
Gene Synonym:ACLP
Exon (5)1045..1167
Gene:AEBP1
Gene Synonym:ACLP
Exon (6)1168..1245
Gene:AEBP1
Gene Synonym:ACLP
Exon (7)1246..1323
Gene:AEBP1
Gene Synonym:ACLP
Exon (8)1324..1401
Gene:AEBP1
Gene Synonym:ACLP
Exon (9)1402..1455
Gene:AEBP1
Gene Synonym:ACLP
Exon (10)1456..1565
Gene:AEBP1
Gene Synonym:ACLP
Exon (11)1566..1705
Gene:AEBP1
Gene Synonym:ACLP
Exon (12)1706..1790
Gene:AEBP1
Gene Synonym:ACLP
Exon (13)1791..1935
Gene:AEBP1
Gene Synonym:ACLP
Exon (14)1936..2021
Gene:AEBP1
Gene Synonym:ACLP
Exon (15)2022..2145
Gene:AEBP1
Gene Synonym:ACLP
Exon (16)2146..2342
Gene:AEBP1
Gene Synonym:ACLP
Exon (17)2343..2522
Gene:AEBP1
Gene Synonym:ACLP
Exon (18)2523..2874
Gene:AEBP1
Gene Synonym:ACLP
Exon (19)2875..3014
Gene:AEBP1
Gene Synonym:ACLP
Exon (20)3015..3114
Gene:AEBP1
Gene Synonym:ACLP
Exon (21)3115..4081
Gene:AEBP1
Gene Synonym:ACLP
Translation MAAVRGAPLLSCLLALLALCPGGRPQTVLTDDEIEEFLEGFLSELEPEPREDDVEAPPPP EPTPRVRKAQAGGKPGKRPGTAAEVPPEKTKDKGKKGKKDKGPKVPKESLEGSPRPPKKG KEKPPKATKKPKEKPPKATKKPKEKPPKATKKPKEKPPKATKKPPSGKRPPILAPSETLE WPLPPPPSPGPEELPQEGGAPLSNNWQNPGEETHVEAREHQPEPEEETEQPTLDYNDQIE REDYEDFEYIRRQKQPRPPPSRRRRPERVWPEPPEEKAPAPAPEERIEPPVKPLLPPLPP DYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEK GKDHKEPRKGEELEEEWTPTEKVKCPPIGMESHRIEDNQIRASSMLRHGLGAQRGRLNMQ TGATEDDYYDGAWCAEDDARTQWIEVDTRRTTRFTGVITQGRDSSIHDDFVTTFFVGFSN DSQTWVMYTNGYEEMTFHGNVDKDTPVLSELPEPVVARFIRIYPLTWNGSLCMRLEVLGC SVAPVYSYYAQNEVVATDDLDFRHHSYKDMRQLMKVVNEECPTITRTYSLGKSSRGLKIY AMEISDNPGEHELGEPEFRYTAGIHGNEVLGRELLLLLMQYLCREYRDGNPRVRSLVQDT RIHLVPSLNPDGYEVAAQMGSEFGNWALGLWTEEGFDIFEDFPDLNSVLWGAEERKWVPY RVPNNNLPIPERYLSPDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVSYPYDMARTPT QEQLLAAAMAAARGEDEDEVSEAQETPDHAIFRWLAISFASAHLTLTEPYRGGCQAQDYT GGMGIVNGAKWNPRTGTINDFSYLHTNCLELSFYLGCDKFPHESELPREWENNKEALLTF MEQVHRGIKGVVTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGY TPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTPQQRRLQQ RRLQHRLRLRAQMRLRRLNATTTLGPHTVPPTLPPAPATTLSTTIEPWGLIPPTTAGWEE SETETYTEVVTEFGTEVEPEFGTKVEPEFETQLEPEFETQLEPEFEEEEEEEKEEEIATG QAFPFTTVETYTVNFGDF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
134+dbSNP:
134+a, cdbSNP:187131829
242+c, gdbSNP:28362520
325+a, cdbSNP:28362521
367+c, tdbSNP:13241299
428+c, tdbSNP:201978706
448+a, gdbSNP:141126404
518+, gdbSNP:112298043
565+dbSNP:
565+c, tdbSNP:75107445
572+c, gdbSNP:139078339
616+a, gdbSNP:145109144
653+a, gdbSNP:201227189
689+c, gdbSNP:200224104
701+a, gdbSNP:199689593
713+c, tdbSNP:147308599
770+a, gdbSNP:201151753
786+a, tdbSNP:112053839
794+a, gdbSNP:201982646
799+c, tdbSNP:140913379
800+a, gdbSNP:144974496
812+a, gdbSNP:200698594
865+c, gdbSNP:200193837
904+dbSNP:
904+c, tdbSNP:139352566
932..933+, adbSNP:34982915
975+dbSNP:
975+c, gdbSNP:200342317
989+c, tdbSNP:148932183
1017+a, cdbSNP:142763648
1028+c, gdbSNP:151068311
1038+a, gdbSNP:201963190
1044+c, tdbSNP:141311453
1058+dbSNP:
1058+a, gdbSNP:145045450
1060+a, gdbSNP:200279382
1122+g, tdbSNP:2537188
1193+dbSNP:
1193+c, tdbSNP:144144167
1196+a, gdbSNP:200809130
1224+a, gdbSNP:138067786
1270+dbSNP:
1270+c, tdbSNP:141003956
1301+c, tdbSNP:2595701
1304+c, tdbSNP:138623215
1305+a, gdbSNP:149248982
1346+dbSNP:
1346+c, gdbSNP:199942462
1408+dbSNP:
1408+a, gdbSNP:75175945
1413+a, gdbSNP:200190216
1446+c, gdbSNP:202186949
1480+dbSNP:
1480+c, tdbSNP:144457398
1486+a, gdbSNP:111888664
1545+c, tdbSNP:137891711
1594+dbSNP:
1594+a, gdbSNP:143568325
1635+a, tdbSNP:61737461
1640+a, gdbSNP:140926602
1663+a, gdbSNP:144784842
1687+a, gdbSNP:199564337
1710+dbSNP:
1710+a, gdbSNP:150909656
1723+c, gdbSNP:139397017
1769+c, tdbSNP:192685042
1781+g, tdbSNP:199596276
1805+dbSNP:
1805+c, tdbSNP:201501212
1813+a, gdbSNP:150055229
1846+c, tdbSNP:200076938
1880+c, gdbSNP:75738447
1905+c, tdbSNP:141206792
1938+dbSNP:
1938+a, c, gdbSNP:143744776
1952+c, tdbSNP:146802668
1976+c, tdbSNP:141019167
1977+a, gdbSNP:143113716
1992+c, tdbSNP:199515795
2001+a, gdbSNP:148240925
2013+a, gdbSNP:140411744
2017+a, gdbSNP:200867650
2021+c, gdbSNP:200212819
2024+dbSNP:
2024+c, tdbSNP:150374163
2034+a, gdbSNP:200666867
2101+g, tdbSNP:137956957
2161+dbSNP:
2161+a, gdbSNP:143372513
2249+a, tdbSNP:11770649
2292+a, cdbSNP:199581509
2324+c, gdbSNP:181697573
2325+a, gdbSNP:184719396
2363+dbSNP:
2363+c, gdbSNP:201455144
2422+a, tdbSNP:200174513
2499+c, tdbSNP:145884426
2539+dbSNP:
2539+c, gdbSNP:138705367
2594+c, tdbSNP:149410697
2601+c, gdbSNP:201912634
2627+c, tdbSNP:201492258
2632+c, tdbSNP:144799697
2651+a, gdbSNP:148555309
2668+c, tdbSNP:200626782
2684+g, tdbSNP:142028646
2694+c, gdbSNP:150691639
2748+c, gdbSNP:140025413
2790+a, cdbSNP:143544464
2841+a, gdbSNP:200145109
2866+g, tdbSNP:201478823
2870+a, cdbSNP:146820958
2888+dbSNP:
2888+a, cdbSNP:139591184
2894+c, tdbSNP:150005580
2895+a, cdbSNP:200012664
2909+c, tdbSNP:145586647
3064+dbSNP:
3064+c, tdbSNP:200487092
3143+dbSNP:
3143+g, tdbSNP:75837861
3155+a, gdbSNP:201507217
3161+c, tdbSNP:148876034
3190+c, tdbSNP:143605377
3248+c, tdbSNP:147631109
3257+c, tdbSNP:141977965
3298+a, gdbSNP:200154504
3307+c, tdbSNP:4724285
3340+a, cdbSNP:145740890
3349+a, tdbSNP:200791707
3396+a, gdbSNP:146344486
3397+c, tdbSNP:141221034
3412+a, gdbSNP:200356275
3452+c, gdbSNP:202072841
3467+c, tdbSNP:113676804
3502+a, gdbSNP:201065802
3536+c, gdbSNP:61736256
3540+a, gdbSNP:138297087
3559+c, tdbSNP:149601977
3591+a, gdbSNP:146155697
3615+a, gdbSNP:140163558
3634+a, gdbSNP:141978884
3639+a, cdbSNP:146312687
3641+a, gdbSNP:148505735
3694+a, gdbSNP:199622819
3695+a, gdbSNP:142895757
3702+a, gdbSNP:13928
3734..3735+, cdbSNP:34841625
3747+a, gdbSNP:13898
3770+c, tdbSNP:113791881
3790+c, tdbSNP:3217972
3883+c, tdbSNP:113592869
3987+a, cdbSNP:1054302
4004+a, gdbSNP:1054306
4011+a, cdbSNP:3217971
4021+a, gdbSNP:11769874
Gene SymbolAEBP1
Gene SynonymACLP
Chromosome7
Locus Map7p13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001129 Homo sapiens AE binding protein 1 (AEBP1), mRNA. Full Length $1435.70
ORF Sequence $1216.95
Title Identification of genomic targets of transcription factor AEBP1 and its role in survival of glioma cells .
Author Ladha,J., Sinha,S., Bhat,V., Donakonda,S. and Rao,S.M.
Journal Mol. Cancer Res. 10 (8), 1039-1051 (2012)
Title PPARgamma1 and LXRalpha face a new regulator of macrophage cholesterol homeostasis and inflammatory responsiveness, AEBP1 .
Author Majdalawieh,A. and Ro,H.S.
Journal Nucl Recept Signal 8, E004 (2010)
Title Aortic carboxypeptidase-like protein is expressed in fibrotic human lung and its absence protects against bleomycin-induced lung fibrosis .
Author Schissel,S.L., Dunsmore,S.E., Liu,X., Shine,R.W., Perrella,M.A. and Layne,M.D.
Journal Am. J. Pathol. 174 (3), 818-828 (2009)
Title The role of AEBP1 in sex-specific diet-induced obesity .
Author Zhang,L., Reidy,S.P., Nicholson,T.E., Lee,H.J., Majdalawieh,A., Webber,C., Stewart,B.R., Dolphin,P. and Ro,H.S.
Journal Mol. Med. 11 (1-12), 39-47 (2005)
Title Impaired abdominal wall development and deficient wound healing in mice lacking aortic carboxypeptidase-like protein .
Author Layne,M.D., Yet,S.F., Maemura,K., Hsieh,C.M., Bernfield,M., Perrella,M.A. and Lee,M.E.
Journal Mol. Cell. Biol. 21 (15), 5256-5261 (2001)
Title Enzymic characterization of a novel member of the regulatory B-like carboxypeptidase with transcriptional repression function: stimulation of enzymic activity by its target DNA .
Author Muise,A.M. and Ro,H.S.
Journal Biochem. J. 343 (PT 2), 341-345 (1999)
Title Aortic carboxypeptidase-like protein, a novel protein with discoidin and carboxypeptidase-like domains, is up-regulated during vascular smooth muscle cell differentiation .
Author Layne,M.D., Endege,W.O., Jain,M.K., Yet,S.F., Hsieh,C.M., Chin,M.T., Perrella,M.A., Blanar,M.A., Haber,E. and Lee,M.E.
Journal J. Biol. Chem. 273 (25), 15654-15660 (1998)
Title A cDNA cloning of human AEBP1 from primary cultured osteoblasts and its expression in a differentiating osteoblastic cell line .
Author Ohno,I., Hashimoto,J., Shimizu,K., Takaoka,K., Ochi,T., Matsubara,K. and Okubo,K.
Journal Biochem. Biophys. Res. Commun. 228 (2), 411-414 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878