• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu13702 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu13702C Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001134938.1, 201023340
Length 1563 bp
Structure linear
Update Date 24-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA.
Product pre-mRNA 3'-end-processing factor FIP1 isoform 3
Comment

Summary: This gene encodes a subunit of the CPSF (cleavage and polyadenylation specificity factor) complex that polyadenylates the 3' end of mRNA precursors. This gene, the homolog of yeast Fip1 (factor interacting with PAP), binds to U-rich sequences of pre-mRNA and stimulates poly(A) polymerase activity. Its N-terminus contains a PAP-binding site and its C-terminus an RNA-binding domain. An interstitial chromosomal deletion on 4q12 creates an in-frame fusion of human genes FIP1L1 and PDGFRA (platelet-derived growth factor receptor, alpha). The FIP1L1-PDGFRA fusion gene encodes a constitutively activated tyrosine kinase that joins the first 233 amino acids of FIP1L1 to the last 523 amino acids of PDGFRA. This gene fusion and chromosomal deletion is the cause of some forms of idiopathic hypereosinophilic syndrome (HES). This syndrome, recently reclassified as chronic eosinophilic leukemia (CEL), is responsive to treatment with tyrosine kinase inhibitors. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008].


Transcript Variant: This variant (3) lacks multiple in-frame exons in the 5' coding region, compared to variant 1. The encoded isoform (3) is shorter than isoform 1.


Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The extent of this transcript is supported by transcript alignments.

RefSeq NP_001128410.1
CDS 187..1749
Misc Feature(1)166..168
Misc Feature(2)598..732
Misc Feature(3)598..732
Exon (1)1..271
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (2)272..311
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (3)312..369
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (4)370..473
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (5)474..538
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (6)539..646
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (7)647..777
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (8)778..887
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (9)888..981
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (10)982..1138
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (11)1139..1193
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (12)1194..1249
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (13)1250..1463
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (14)1464..1601
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Exon (15)1602..2236
Gene:FIP1L1
Gene Synonym:FIP1; hFip1; Rhe
Translation MSAGEVERLVSELSGGTGGDEEEEWLYGDENEVERPEEENASANPPSGIEDETAENGVPK PKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNLNIKTGGRVYGTTGTK VKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRI RMGLEVIPVTSTTNKITVQQGRTGNSEKETALPSTKAEFTSPPSLFKTGLPPSRRLPGAI DVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFFPPGAPPTHLPPPPF LPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRSARAFPYGNVAFPHL PGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRERDRDRDRERERTRERERERDHSPT PSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETRHKSSRSNSRRRHES EEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQESTEATPAE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
7+dbSNP:
7+c, gdbSNP:139542760
10+c, tdbSNP:144852148
77+g, tdbSNP:182333587
86+c, tdbSNP:3811782
174+a, gdbSNP:374139129
179+a, gdbSNP:377730833
208+c, tdbSNP:372660290
234+c, gdbSNP:376917506
279+dbSNP:
279+c, tdbSNP:199730748
284+c, tdbSNP:367710840
307+c, gdbSNP:371676507
352+dbSNP:
352+a, cdbSNP:148420010
389+dbSNP:
389+a, cdbSNP:370672369
416+a, tdbSNP:374375670
489+dbSNP:
489+a, cdbSNP:143506497
629+dbSNP:
629+a, cdbSNP:147147160
692+dbSNP:
692+a, cdbSNP:372681089
717+a, gdbSNP:146788332
746+c, tdbSNP:376947009
825+dbSNP:
825+a, gdbSNP:151105925
881+c, tdbSNP:139886150
882+a, gdbSNP:149817693
933+dbSNP:
933+c, tdbSNP:201620527
973+a, gdbSNP:112568587
1035+dbSNP:
1035+c, tdbSNP:267600183
1092+a, cdbSNP:79276443
1140+dbSNP:
1140+, tdbSNP:34147078
1158+c, tdbSNP:372844088
1174+c, gdbSNP:375777501
1219+dbSNP:
1219+c, tdbSNP:376873739
1231+g, tdbSNP:145680928
1283+dbSNP:
1283+c, tdbSNP:368570756
1284+a, gdbSNP:112870891
1326+c, tdbSNP:112251209
1376+a, gdbSNP:141173684
1405+c, tdbSNP:143186301
1411..1412+, agdbSNP:143671659
1434+a, tdbSNP:200359590
1464+dbSNP:
1464+c, tdbSNP:371406567
1568..1569+a, gdbSNP:11543418
1649+dbSNP:
1649+a, gdbSNP:15887
1686+a, cdbSNP:148264857
1694+c, tdbSNP:377576240
1713+c, tdbSNP:113411128
1725+c, gdbSNP:141265672
1730+a, gdbSNP:373400192
1743+a, gdbSNP:377424821
1754+c, gdbSNP:370193198
1780+a, gdbSNP:146451478
1936..1937+, tadbSNP:372095261
1997+c, tdbSNP:140681259
2123+c, tdbSNP:1014056
2221+c, tdbSNP:112778100
2235+c, tdbSNP:150449377
Gene SymbolFIP1L1
Gene SynonymFIP1; hFip1; Rhe
Chromosome4
Locus Map4q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001134938 Homo sapiens factor interacting with PAPOLA and CPSF1 (FIP1L1), transcript variant 3, mRNA. On-demand $219.00 7-9
Title The FIP1L1-PDGFRA fusion gene and the KIT D816V mutation are coexisting in a small subset of myeloid/lymphoid neoplasms with eosinophilia .
Author Schmitt-Graeff AH, Erben P, Schwaab J, Vollmer-Kary B, Metzgeroth G, Sotlar K, Horny HP, Kreipe HH, Fisch P and Reiter A.
Journal Blood 123 (4), 595-597 (2014)
Title GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association .
Author Renteria ME, Coolen MW, Statham AL, Choi RS, Qu W, Campbell MJ, Smith S, Henders AK, Montgomery GW, Clark SJ, Martin NG and Medland SE.
Journal Twin Res Hum Genet 16 (4), 767-781 (2013)
Title Oncostatin M is a FIP1L1/PDGFRA-dependent mediator of cytokine production in chronic eosinophilic leukemia .
Author Hoermann G, Cerny-Reiterer S, Sadovnik I, Mullauer L, Bilban M, Groger M, Horny HP, Reiter A, Schmitt-Graeff A, Mannhalter C, Valent P and Mayerhofer M.
Journal Allergy 68 (6), 713-723 (2013)
Title Case of polycythemia vera concurrent with FIP1L1-PDGFRA-positive myeloproliferative neoplasm with eosinophilia .
Author Alrwas A, Quesada JR, Marcos LA, Mehta SS, Shattuck BL, Nguyen ND and Juneja HS.
Journal Cancer Genet 205 (10), 519-522 (2012)
Title Identification of JAK2 as a mediator of FIP1L1-PDGFRA-induced eosinophil growth and function in CEL .
Author Li B, Zhang G, Li C, He D, Li X, Zhang C, Tang F, Deng X, Lu J, Tang Y, Li R, Chen Z and Duan C.
Journal PLoS ONE 7 (4), E34912 (2012)
Title The EOL-1 cell line as an in vitro model for the study of FIP1L1-PDGFRA-positive chronic eosinophilic leukemia .
Author Cools J, Quentmeier H, Huntly BJ, Marynen P, Griffin JD, Drexler HG and Gilliland DG.
Journal Blood 103 (7), 2802-2805 (2004)
Title Human Fip1 is a subunit of CPSF that binds to U-rich RNA elements and stimulates poly(A) polymerase .
Author Kaufmann I, Martin G, Friedlein A, Langen H and Keller W.
Journal EMBO J. 23 (3), 616-626 (2004)
Title CHIC2 deletion, a surrogate for FIP1L1-PDGFRA fusion, occurs in systemic mastocytosis associated with eosinophilia and predicts response to imatinib mesylate therapy .
Author Pardanani A, Ketterling RP, Brockman SR, Flynn HC, Paternoster SF, Shearer BM, Reeder TL, Li CY, Cross NC, Cools J, Gilliland DG, Dewald GW and Tefferi A.
Journal Blood 102 (9), 3093-3096 (2003)
Title Discovery of a fusion kinase in EOL-1 cells and idiopathic hypereosinophilic syndrome .
Author Griffin JH, Leung J, Bruner RJ, Caligiuri MA and Briesewitz R.
Journal Proc. Natl. Acad. Sci. U.S.A. 100 (13), 7830-7835 (2003)
Title A tyrosine kinase created by fusion of the PDGFRA and FIP1L1 genes as a therapeutic target of imatinib in idiopathic hypereosinophilic syndrome .
Author Cools J, DeAngelo DJ, Gotlib J, Stover EH, Legare RD, Cortes J, Kutok J, Clark J, Galinsky I, Griffin JD, Cross NC, Tefferi A, Malone J, Alam R, Schrier SL, Schmid J, Rose M, Vandenberghe P, Verhoef G, Boogaerts M, Wlodarska I, Kantarjian H, Marynen P, Coutre SE, Stone R and Gilliland DG.
Journal N. Engl. J. Med. 348 (13), 1201-1214 (2003)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.