• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens FIP1 like 1 (S. cerevisiae) (FIP1L1), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001134938 Homo sapiens FIP1 like 1 (S. cerevisiae) (FIP1L1), transcript variant 3, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_001134938.1, 201023340
Length 2236 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens FIP1 like 1 (S. cerevisiae) (FIP1L1), transcript variant 3, mRNA.
Product pre-mRNA 3'-end-processing factor FIP1 isoform 3
Comment

Summary: This gene encodes a subunit of the CPSF (cleavage and polyadenylation specificity factor) complex that polyadenylates the 3' end of mRNA precursors. This gene, the homolog of yeast Fip1 (factor interacting with PAP), binds to U-rich sequences of pre-mRNA and stimulates poly(A) polymerase activity. Its N-terminus contains a PAP-binding site and its C-terminus an RNA-binding domain. An interstitial chromosomal deletion on 4q12 creates an in-frame fusion of human genes FIP1L1 and PDGFRA (platelet-derived growth factor receptor, alpha). The FIP1L1-PDGFRA fusion gene encodes a constitutively activated tyrosine kinase that joins the first 233 amino acids of FIP1L1 to the last 523 amino acids of PDGFRA. This gene fusion and chromosomal deletion is the cause of some forms of idiopathic hypereosinophilic syndrome (HES). This syndrome, recently reclassified as chronic eosinophilic leukemia (CEL), is responsive to treatment with tyrosine kinase inhibitors. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008].


Transcript Variant: This variant (3) lacks multiple in-frame exons in the 5' coding region, compared to variant 1. The encoded isoform (3) is shorter than isoform 1.


Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The extent of this transcript is supported by transcript alignments.

RefSeq NP_001128410.1
CDS 187..1749
Misc Feature(1)166..168
Misc Feature(2)598..732
Misc Feature(3)598..732
Exon (1)1..271
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (2)272..311
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (3)312..369
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (4)370..473
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (5)474..538
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (6)539..646
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (7)647..777
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (8)778..887
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (9)888..981
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (10)982..1138
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (11)1139..1193
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (12)1194..1249
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (13)1250..1463
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (14)1464..1601
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Exon (15)1602..2236
Gene:FIP1L1
Gene Synonym:hFip1; Rhe
Translation MSAGEVERLVSELSGGTGGDEEEEWLYGDENEVERPEEENASANPPSGIEDETAENGVPK PKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNLNIKTGGRVYGTTGTK VKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRI RMGLEVIPVTSTTNKITVQQGRTGNSEKETALPSTKAEFTSPPSLFKTGLPPSRRLPGAI DVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFFPPGAPPTHLPPPPF LPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRSARAFPYGNVAFPHL PGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRERDRDRDRERERTRERERERDHSPT PSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETRHKSSRSNSRRRHES EEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQESTEATPAE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
7+dbSNP:
7+c, gdbSNP:139542760
10+c, tdbSNP:144852148
77+g, tdbSNP:182333587
86+c, tdbSNP:3811782
279+dbSNP:
279+c, tdbSNP:199730748
352+dbSNP:
352+a, cdbSNP:148420010
489+dbSNP:
489+a, cdbSNP:143506497
629+dbSNP:
629+a, cdbSNP:147147160
717+dbSNP:
717+a, gdbSNP:146788332
825+dbSNP:
825+a, gdbSNP:151105925
881+c, tdbSNP:139886150
882+a, gdbSNP:149817693
933+dbSNP:
933+c, tdbSNP:201620527
973+a, gdbSNP:112568587
1092+dbSNP:
1092+a, cdbSNP:79276443
1140+dbSNP:
1140+, tdbSNP:34147078
1231+dbSNP:
1231+g, tdbSNP:145680928
1284+dbSNP:
1284+a, gdbSNP:112870891
1326+c, tdbSNP:112251209
1376+a, gdbSNP:141173684
1405+c, tdbSNP:143186301
1411..1412+, agdbSNP:143671659
1434+a, tdbSNP:200359590
1568..1569+dbSNP:
1568..1569+a, gdbSNP:11543418
1649+dbSNP:
1649+a, gdbSNP:15887
1686+a, cdbSNP:148264857
1713+c, tdbSNP:113411128
1725+c, gdbSNP:141265672
1780+a, gdbSNP:146451478
1997+c, tdbSNP:140681259
2123+c, tdbSNP:1014056
2221+c, tdbSNP:112778100
2235+c, tdbSNP:150449377
Gene SymbolFIP1L1
Gene SynonymhFip1; Rhe
Chromosome4
Locus Map4q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001134937 Homo sapiens FIP1 like 1 (S. cerevisiae) (FIP1L1), transcript variant 2, mRNA. On-demand $849.00 20
NM_001134938 Homo sapiens FIP1 like 1 (S. cerevisiae) (FIP1L1), transcript variant 3, mRNA. On-demand $699.00 18
NM_030917 Homo sapiens FIP1 like 1 (S. cerevisiae) (FIP1L1), transcript variant 1, mRNA. On-demand $849.00 20
Title Case of polycythemia vera concurrent with FIP1L1-PDGFRA-positive myeloproliferative neoplasm with eosinophilia .
Author Alrwas,A., Quesada,J.R., Marcos,L.A., Mehta,S.S., Shattuck,B.L., Nguyen,N.D. and Juneja,H.S.
Journal Cancer Genet 205 (10), 519-522 (2012)
Title Cyclin-dependent kinase 7/9 inhibitor SNS-032 abrogates FIP1-like-1 platelet-derived growth factor receptor alpha and bcr-abl oncogene addiction in malignant hematologic cells .
Author Wu,Y., Chen,C., Sun,X., Shi,X., Jin,B., Ding,K., Yeung,S.C. and Pan,J.
Journal Clin. Cancer Res. 18 (7), 1966-1978 (2012)
Title Limited clinical activity of nilotinib and sorafenib in FIP1L1-PDGFRA positive chronic eosinophilic leukemia with imatinib-resistant T674I mutation .
Author Metzgeroth,G., Erben,P., Martin,H., Mousset,S., Teichmann,M., Walz,C., Klippstein,T., Hochhaus,A., Cross,N.C., Hofmann,W.K. and Reiter,A.
Journal Leukemia 26 (1), 162-164 (2012)
Title Identification of JAK2 as a mediator of FIP1L1-PDGFRA-induced eosinophil growth and function in CEL .
Author Li,B., Zhang,G., Li,C., He,D., Li,X., Zhang,C., Tang,F., Deng,X., Lu,J., Tang,Y., Li,R., Chen,Z. and Duan,C.
Journal PLoS ONE 7 (4), E34912 (2012)
Title [Genetic mutations and molecularly-targeted drugs in hypereosinophilic syndromes] .
Author Yamada,Y.
Journal Arerugi 60 (2), 167-177 (2011)
Title The EOL-1 cell line as an in vitro model for the study of FIP1L1-PDGFRA-positive chronic eosinophilic leukemia .
Author Cools,J., Quentmeier,H., Huntly,B.J., Marynen,P., Griffin,J.D., Drexler,H.G. and Gilliland,D.G.
Journal Blood 103 (7), 2802-2805 (2004)
Title Human Fip1 is a subunit of CPSF that binds to U-rich RNA elements and stimulates poly(A) polymerase .
Author Kaufmann,I., Martin,G., Friedlein,A., Langen,H. and Keller,W.
Journal EMBO J. 23 (3), 616-626 (2004)
Title CHIC2 deletion, a surrogate for FIP1L1-PDGFRA fusion, occurs in systemic mastocytosis associated with eosinophilia and predicts response to imatinib mesylate therapy .
Author Pardanani,A., Ketterling,R.P., Brockman,S.R., Flynn,H.C., Paternoster,S.F., Shearer,B.M., Reeder,T.L., Li,C.Y., Cross,N.C., Cools,J., Gilliland,D.G., Dewald,G.W. and Tefferi,A.
Journal Blood 102 (9), 3093-3096 (2003)
Title Discovery of a fusion kinase in EOL-1 cells and idiopathic hypereosinophilic syndrome .
Author Griffin,J.H., Leung,J., Bruner,R.J., Caligiuri,M.A. and Briesewitz,R.
Journal Proc. Natl. Acad. Sci. U.S.A. 100 (13), 7830-7835 (2003)
Title A tyrosine kinase created by fusion of the PDGFRA and FIP1L1 genes as a therapeutic target of imatinib in idiopathic hypereosinophilic syndrome .
Author Cools,J., DeAngelo,D.J., Gotlib,J., Stover,E.H., Legare,R.D., Cortes,J., Kutok,J., Clark,J., Galinsky,I., Griffin,J.D., Cross,N.C., Tefferi,A., Malone,J., Alam,R., Schrier,S.L., Schmid,J., Rose,M., Vandenberghe,P., Verhoef,G., Boogaerts,M., Wlodarska,I., Kantarjian,H., Marynen,P., Coutre,S.E., Stone,R. and Gilliland,D.G.
Journal N. Engl. J. Med. 348 (13), 1201-1214 (2003)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.