• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dynactin 1 (DCTN1), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001135040 Homo sapiens dynactin 1 (DCTN1), transcript variant 3, mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_001135040.2, 299890880
Length 4443 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens dynactin 1 (DCTN1), transcript variant 3, mRNA.
Product dynactin subunit 1 isoform 3
Comment

Summary: This gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. Dynactin is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit interacts with dynein intermediate chain by its domains directly binding to dynein and binds to microtubules via a highly conserved glycine-rich cytoskeleton-associated protein (CAP-Gly) domain in its N-terminus. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause distal hereditary motor neuronopathy type VIIB (HMN7B) which is also known as distal spinal and bulbar muscular atrophy (dSBMA). [provided by RefSeq, Oct 2008].


Transcript Variant: This variant (3) has multiple differences in the 5' coding region and 5' UTR, compared to variant 4. These differences cause translation initiation from an upstream AUG and a protein (isoform 3) with a longer N-terminus containing a CAP-Gly domain, compared to isoform 4.

RefSeq NP_001128512.1
CDS 319..4080
Misc Feature(1)253..255
Misc Feature(2)403..603
Misc Feature(3)403..603
Misc Feature(4)640..642
Misc Feature(5)1834..2673
Misc Feature(6)<3223..3369
Exon (1)1..351
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (2)352..597
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (3)598..676
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (4)677..711
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (5)712..903
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (6)904..1101
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (7)1102..1306
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (8)1307..1385
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (9)1386..1545
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (10)1546..1650
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (11)1651..1842
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (12)1843..1959
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (13)1960..2112
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (14)2113..2273
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (15)2274..2442
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (16)2443..2511
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (17)2512..2574
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (18)2575..2724
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (19)2725..2886
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (20)2887..3018
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (21)3019..3144
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (22)3145..3287
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (23)3288..3454
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (24)3455..3588
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (25)3589..3772
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (26)3773..3852
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (27)3853..3942
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (28)3943..4425
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Translation MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKRE GTDTTAKTSKLPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPV LTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQE WKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAES LQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDL SSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMV EMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQ KRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFA ETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAE LIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVD VYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPE DCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDIALLLRDLETSCSDIRQFCKK IRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEG LLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSK PPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKL DSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQ SKRTIEGLRGPPPSGIATLVSGIAGGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHIS QLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTH THVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFAT FPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(5)-dbSNP:
complement(5)-g, cdbSNP:184149028
complement(192)-t, cdbSNP:76761391
complement(256)-t, cdbSNP:146192914
complement(353)-dbSNP:
complement(353)-t, cdbSNP:72659364
complement(361)-g, adbSNP:72466482
complement(363)-t, cdbSNP:72466483
complement(378)-t, cdbSNP:150204862
complement(392)-t, cdbSNP:138297224
complement(418)-g, cdbSNP:151052060
complement(493)-g, adbSNP:121909342
complement(495)-t, cdbSNP:72466484
complement(496)-g, cdbSNP:74768853
complement(506)-t, cdbSNP:202162824
complement(529)-g, adbSNP:72466485
complement(530)-g, c, adbSNP:67586389
complement(532)-c, adbSNP:72466486
complement(539)-c, adbSNP:72466487
complement(576)-g, adbSNP:140054458
complement(578)-t, cdbSNP:72466488
complement(643)-dbSNP:
complement(643)-t, gdbSNP:146896442
complement(718)-dbSNP:
complement(718)-g, adbSNP:141670992
complement(816)-t, cdbSNP:201078804
complement(844)-t, cdbSNP:55862001
complement(854)-t, cdbSNP:11555695
complement(855)-t, cdbSNP:143607419
complement(884)-g, cdbSNP:112725508
complement(885)-c, adbSNP:147673066
complement(916)-dbSNP:
complement(916)-g, adbSNP:13017253
complement(958)-g, adbSNP:13017086
complement(980)-t, gdbSNP:12993079
complement(1000)-g, adbSNP:112475795
complement(1070)-t, cdbSNP:141690101
complement(1095)-g, adbSNP:72466489
complement(1110)-dbSNP:
complement(1110)-t, cdbSNP:199672121
complement(1116)-t, cdbSNP:151107870
complement(1117)-t, gdbSNP:13420401
complement(1217)-g, adbSNP:149526947
complement(1257)-g, cdbSNP:200952455
complement(1353)-dbSNP:
complement(1353)-t, cdbSNP:115088049
complement(1363)-g, adbSNP:149499018
complement(1419)-dbSNP:
complement(1419)-g, adbSNP:72659373
complement(1483)-g, adbSNP:150368544
complement(1484)-t, cdbSNP:142318791
complement(1490)-c, adbSNP:186892779
complement(1508)-t, cdbSNP:141376555
complement(1526)-g, adbSNP:201127181
complement(1539)-t, cdbSNP:147048495
complement(1614)-dbSNP:
complement(1614)-t, cdbSNP:200138600
complement(1678)-dbSNP:
complement(1678)-g, adbSNP:139100051
complement(1680)-t, cdbSNP:149184538
complement(1695)-c, adbSNP:138045336
complement(1700)-t, gdbSNP:201364385
complement(1705)-g, adbSNP:145369076
complement(1723)-g, cdbSNP:35535161
complement(1728)-g, adbSNP:199751168
complement(1738)-t, cdbSNP:113980038
complement(1741)-g, adbSNP:184840910
complement(1742)-t, cdbSNP:17721059
complement(1762)-t, g, adbSNP:145958900
complement(1781)-t, cdbSNP:148449665
complement(1863)-dbSNP:
complement(1863)-t, cdbSNP:13429423
complement(1868)-t, gdbSNP:4994503
complement(1874)-t, gdbSNP:4994504
complement(1875)-t, cdbSNP:139061654
complement(1920)-g, adbSNP:188566922
complement(1960)-dbSNP:
complement(1960)-c, adbSNP:201348349
complement(1970)-t, cdbSNP:121909343
complement(1986)-t, cdbSNP:141010407
complement(2106)-c, adbSNP:199812721
complement(2164)-dbSNP:
complement(2164)-c, adbSNP:148138436
complement(2174)-t, cdbSNP:201095249
complement(2194)-c, adbSNP:146865209
complement(2255)-g, adbSNP:143914684
complement(2256)-t, cdbSNP:149900553
complement(2263)-g, adbSNP:150746209
complement(2264)-t, cdbSNP:140523637
complement(2289)-dbSNP:
complement(2289)-g, adbSNP:112930313
complement(2323)-t, adbSNP:72659377
complement(2394)-g, adbSNP:147297927
complement(2452)-dbSNP:
complement(2452)-t, cdbSNP:202214010
complement(2471)-t, cdbSNP:143800457
complement(2516)-dbSNP:
complement(2516)-g, adbSNP:143763184
complement(2517)-t, cdbSNP:200275059
complement(2555)-t, cdbSNP:200611961
complement(2592)-dbSNP:
complement(2592)-t, gdbSNP:144256653
complement(2611)-t, cdbSNP:121909344
complement(2612)-g, adbSNP:72466492
complement(2623)-t, gdbSNP:201592072
complement(2640)-t, gdbSNP:142107482
complement(2655)-t, cdbSNP:145150561
complement(2690)-g, cdbSNP:150928856
complement(2706)-g, adbSNP:1130484
complement(2750)-dbSNP:
complement(2750)-t, cdbSNP:140485294
complement(2776)-g, cdbSNP:145293019
complement(2781)-c, adbSNP:199501797
complement(2807)-t, gdbSNP:75213803
complement(2809)-g, cdbSNP:72659379
complement(2846)-g, adbSNP:150798076
complement(2863)-g, adbSNP:148511573
complement(2881)-t, cdbSNP:201063854
complement(2904)-dbSNP:
complement(2904)-g, adbSNP:191073199
complement(2907)-g, adbSNP:140986485
complement(2972)-g, adbSNP:201949927
complement(2994)-t, cdbSNP:72659381
complement(3001)-c, adbSNP:75503452
complement(3034)-dbSNP:
complement(3034)-t, gdbSNP:201914453
complement(3063)-g, cdbSNP:145130328
complement(3093)-t, gdbSNP:138305126
complement(3103)-t, cdbSNP:199780349
complement(3168)-dbSNP:
complement(3168)-g, adbSNP:182000383
complement(3231)-g, adbSNP:140969689
complement(3248)-t, cdbSNP:200580530
complement(3280)-t, cdbSNP:112395789
complement(3385)-dbSNP:
complement(3385)-g, adbSNP:140066692
complement(3395)-t, cdbSNP:145857843
complement(3404)-g, adbSNP:72659383
complement(3471)-dbSNP:
complement(3471)-t, cdbSNP:202237523
complement(3493)-g, adbSNP:201918007
complement(3513)-t, cdbSNP:148457249
complement(3545)-g, adbSNP:121909345
complement(3577)-t, cdbSNP:187434401
complement(3687)-dbSNP:
complement(3687)-t, cdbSNP:139241420
complement(3733)-g, adbSNP:72466493
complement(3741)-t, cdbSNP:142030960
complement(3762)-g, adbSNP:146094433
complement(3766)-t, adbSNP:199669902
complement(3780)-dbSNP:
complement(3780)-g, cdbSNP:148146325
complement(3789)-t, cdbSNP:149440626
complement(3800)-g, adbSNP:145819459
complement(3801)-t, cdbSNP:200834352
complement(3816)-t, cdbSNP:137966704
complement(3823)-g, adbSNP:112571739
complement(3837)-g, adbSNP:115689748
complement(3866)-dbSNP:
complement(3866)-t, cdbSNP:142211487
complement(3869)-t, cdbSNP:150386917
complement(3886)-g, cdbSNP:184147813
complement(3931)-g, adbSNP:72466495
complement(3956)-dbSNP:
complement(3956)-t, cdbSNP:200095976
complement(3964)-t, cdbSNP:184429549
complement(3989)-t, cdbSNP:72466496
complement(4042)-t, g, cdbSNP:146083590
complement(4086)-g, adbSNP:200676625
complement(4101)-t, cdbSNP:11555696
complement(4183)-t, cdbSNP:151150356
complement(4185)-g, cdbSNP:185694177
complement(4247)-g, adbSNP:142053202
complement(4319)-g, adbSNP:140263124
complement(4352)-c, adbSNP:17009890
complement(4414)-t, cdbSNP:3177776
Gene SymbolDCTN1
Gene SynonymDAP-150; DP-150; P135
Chromosome2
Locus Map2p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001135040 Homo sapiens dynactin 1 (DCTN1), transcript variant 3, mRNA. On-demand $1699.00 25
NM_001135041 Homo sapiens dynactin 1 (DCTN1), transcript variant 4, mRNA. On-demand $1699.00 25
NM_001190836 Homo sapiens dynactin 1 (DCTN1), transcript variant 5, mRNA. On-demand $1699.00 25
NM_001190837 Homo sapiens dynactin 1 (DCTN1), transcript variant 6, mRNA. On-demand $1699.00 25
NM_004082 Homo sapiens dynactin 1 (DCTN1), transcript variant 1, mRNA. On-demand $1699.00 25
NM_023019 Homo sapiens dynactin 1 (DCTN1), transcript variant 2, mRNA. On-demand $1699.00 25
Title Kif3a interacts with Dynactin subunit p150 Glued to organize centriole subdistal appendages .
Author Kodani,A., Salome Sirerol-Piquer,M., Seol,A., Garcia-Verdugo,J.M. and Reiter,J.F.
Journal EMBO J. 32 (4), 597-607 (2013)
Title Characterization of functional domains of human EB1 family proteins .
Author Bu,W. and Su,L.K.
Journal J. Biol. Chem. 278 (50), 49721-49731 (2003)
Title Evidence that an interaction between EB1 and p150(Glued) is required for the formation and maintenance of a radial microtubule array anchored at the centrosome .
Author Askham,J.M., Vaughan,K.T., Goodson,H.V. and Morrison,E.E.
Journal Mol. Biol. Cell 13 (10), 3627-3645 (2002)
Title Genomic organization of the DCTN1-SLC4A5 locus encoding both NBC4 and p150(Glued) .
Author Pushkin,A., Abuladze,N., Newman,D., Tatishchev,S. and Kurtz,I.
Journal Cytogenet. Cell Genet. 95 (3-4), 163-168 (2001)
Title Cloning, characterization and chromosomal assignment of NBC4, a new member of the sodium bicarbonate cotransporter family .
Author Pushkin,A., Abuladze,N., Newman,D., Lee,I., Xu,G. and Kurtz,I.
Journal Biochim. Biophys. Acta 1493 (1-2), 215-218 (2000)
Title The genomic structure of DCTN1, a candidate gene for limb-girdle muscular dystrophy (LGMD2B) .
Author Tokito,M.K. and Holzbaur,E.L.
Journal Biochim. Biophys. Acta 1442 (2-3), 432-436 (1998)
Title Human DCTN1: genomic structure and evaluation as a candidate for Alstrom syndrome .
Author Collin,G.B., Nishina,P.M., Marshall,J.D. and Naggert,J.K.
Journal Genomics 53 (3), 359-364 (1998)
Title Characterization of the p22 subunit of dynactin reveals the localization of cytoplasmic dynein and dynactin to the midbody of dividing cells .
Author Karki,S., LaMonte,B. and Holzbaur,E.L.
Journal J. Cell Biol. 142 (4), 1023-1034 (1998)
Title Localization of the DCTN1 gene encoding p150Glued to human chromosome 2p13 by fluorescence in situ hybridization .
Author Holzbaur,E.L. and Tokito,M.K.
Journal Genomics 31 (3), 398-399 (1996)
Title Homology of a 150K cytoplasmic dynein-associated polypeptide with the Drosophila gene Glued .
Author Holzbaur,E.L., Hammarback,J.A., Paschal,B.M., Kravit,N.G., Pfister,K.K. and Vallee,R.B.
Journal Nature 351 (6327), 579-583 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.