• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dynactin 1 (DCTN1), transcript variant 3, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu16796 Homo sapiens dynactin 1 (DCTN1), transcript variant 3, mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu16796C Homo sapiens dynactin 1 (DCTN1), transcript variant 3, mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001135040.2, 299890880
Length 3762 bp
Structure linear
Update Date 20-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens dynactin 1 (DCTN1), transcript variant 3, mRNA.
Product dynactin subunit 1 isoform 3
Comment

Summary: This gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. Dynactin is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit interacts with dynein intermediate chain by its domains directly binding to dynein and binds to microtubules via a highly conserved glycine-rich cytoskeleton-associated protein (CAP-Gly) domain in its N-terminus. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause distal hereditary motor neuronopathy type VIIB (HMN7B) which is also known as distal spinal and bulbar muscular atrophy (dSBMA). [provided by RefSeq, Oct 2008].


Transcript Variant: This variant (3) has multiple differences in the 5' coding region and 5' UTR, compared to variant 4. These differences cause translation initiation from an upstream AUG and a protein (isoform 3) with a longer N-terminus containing a CAP-Gly domain, compared to isoform 4.

RefSeq NP_001128512.1
CDS 319..4080
Misc Feature(1)253..255
Misc Feature(2)403..603
Misc Feature(3)403..603
Misc Feature(4)640..642
Misc Feature(5)<724..1008
Misc Feature(6)889..>1248
Misc Feature(7)994..1380
Misc Feature(8)<1012..1551
Misc Feature(9)1198..1755
Misc Feature(10)1834..2673
Misc Feature(11)<3175..3402
Exon (1)1..351
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (2)352..597
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (3)598..676
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (4)677..711
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (5)712..903
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (6)904..1101
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (7)1102..1306
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (8)1307..1385
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (9)1386..1545
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (10)1546..1650
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (11)1651..1842
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (12)1843..1959
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (13)1960..2112
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (14)2113..2273
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (15)2274..2442
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (16)2443..2511
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (17)2512..2574
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (18)2575..2724
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (19)2725..2886
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (20)2887..3018
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (21)3019..3144
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (22)3145..3287
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (23)3288..3454
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (24)3455..3588
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (25)3589..3772
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (26)3773..3852
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (27)3853..3942
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Exon (28)3943..4425
Gene:DCTN1
Gene Synonym:DAP-150; DP-150; P135
Translation MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKRE GTDTTAKTSKLPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPV LTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQE WKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAES LQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDL SSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMV EMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQ KRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFA ETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAE LIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVD VYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPE DCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDIALLLRDLETSCSDIRQFCKK IRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEG LLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSK PPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKL DSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQ SKRTIEGLRGPPPSGIATLVSGIAGGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHIS QLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTH THVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFAT FPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(5)-dbSNP:
complement(5)-g, cdbSNP:184149028
complement(115)-t, cdbSNP:367752687
complement(192)-t, cdbSNP:76761391
complement(235)-g, adbSNP:371764844
complement(256)-t, cdbSNP:146192914
complement(339)-g, adbSNP:373040626
353+dbSNP:
353+c, tdbSNP:72659364
361+a, gdbSNP:72466482
363+c, tdbSNP:72466483
complement(378)-t, cdbSNP:150204862
complement(388)-c, adbSNP:372733713
complement(390)-g, adbSNP:368633620
complement(392)-t, cdbSNP:138297224
complement(418)-g, cdbSNP:151052060
493+a, gdbSNP:121909342
495+c, tdbSNP:72466484
complement(496)-g, cdbSNP:74768853
complement(506)-t, cdbSNP:202162824
529+a, gdbSNP:72466485
530+a, c, gdbSNP:67586389
532+a, cdbSNP:72466486
539+a, cdbSNP:72466487
complement(576)-g, adbSNP:140054458
578+c, tdbSNP:72466488
complement(643)-dbSNP:
complement(643)-t, gdbSNP:146896442
complement(650)-g, cdbSNP:374419252
complement(654)-c, adbSNP:371005095
complement(718)-dbSNP:
complement(718)-g, adbSNP:141670992
complement(749)-t, cdbSNP:370624168
complement(777)-t, cdbSNP:376565787
complement(816)-t, cdbSNP:201078804
complement(844)-t, cdbSNP:55862001
854+c, tdbSNP:11555695
complement(855)-t, cdbSNP:143607419
complement(856)-c, adbSNP:369722109
complement(884)-g, cdbSNP:112725508
complement(885)-c, adbSNP:147673066
complement(916)-dbSNP:
complement(916)-g, adbSNP:13017253
complement(931)-g, adbSNP:371723224
complement(958)-g, adbSNP:13017086
complement(980)-t, gdbSNP:12993079
complement(1000)-g, adbSNP:112475795
complement(1046)-c, adbSNP:368273709
complement(1082)-t, cdbSNP:375266113
complement(1095)-g, adbSNP:72466489
complement(1110)-dbSNP:
complement(1110)-t, cdbSNP:199672121
complement(1116)-t, cdbSNP:151107870
complement(1117)-t, gdbSNP:13420401
complement(1217)-g, adbSNP:149526947
complement(1257)-g, cdbSNP:200952455
complement(1353)-dbSNP:
complement(1353)-t, cdbSNP:115088049
complement(1363)-g, adbSNP:149499018
1419+dbSNP:
1419+a, gdbSNP:72659373
complement(1436)-t, cdbSNP:375072134
complement(1483)-g, adbSNP:150368544
complement(1484)-t, cdbSNP:142318791
complement(1490)-c, adbSNP:186892779
complement(1508)-t, cdbSNP:141376555
complement(1524)-g, adbSNP:368742342
complement(1526)-g, adbSNP:201127181
complement(1614)-dbSNP:
complement(1614)-t, cdbSNP:200138600
complement(1656)-dbSNP:
complement(1656)-t, cdbSNP:371253917
complement(1678)-g, adbSNP:139100051
complement(1680)-t, cdbSNP:149184538
complement(1695)-c, adbSNP:138045336
complement(1700)-t, gdbSNP:201364385
complement(1705)-g, adbSNP:145369076
complement(1723)-g, cdbSNP:35535161
complement(1728)-g, adbSNP:199751168
complement(1738)-t, cdbSNP:113980038
complement(1740)-t, cdbSNP:372546194
complement(1741)-g, adbSNP:184840910
complement(1742)-t, cdbSNP:17721059
complement(1742)-t, cdbSNP:386544373
complement(1748)-t, cdbSNP:369086889
complement(1762)-t, g, adbSNP:145958900
complement(1781)-t, cdbSNP:148449665
complement(1806)-g, adbSNP:369546374
complement(1831)-t, cdbSNP:376564889
complement(1850)-dbSNP:
complement(1850)-t, cdbSNP:367910524
complement(1863)-t, cdbSNP:13429423
complement(1868)-t, gdbSNP:4994503
complement(1874)-t, gdbSNP:4994504
complement(1875)-t, cdbSNP:139061654
complement(1913)-g, adbSNP:368350710
complement(1920)-g, adbSNP:188566922
complement(1960)-dbSNP:
complement(1960)-c, adbSNP:201348349
1970+c, tdbSNP:121909343
complement(1986)-t, cdbSNP:141010407
complement(2028)-g, adbSNP:373649455
complement(2060)-g, cdbSNP:370192633
complement(2074)-t, cdbSNP:375778151
complement(2095)-g, adbSNP:372808221
complement(2106)-c, adbSNP:199812721
complement(2164)-dbSNP:
complement(2164)-c, adbSNP:148138436
complement(2174)-t, cdbSNP:201095249
complement(2194)-c, adbSNP:146865209
complement(2255)-g, adbSNP:143914684
complement(2256)-t, cdbSNP:149900553
complement(2263)-g, adbSNP:150746209
complement(2264)-t, cdbSNP:140523637
complement(2277)-dbSNP:
complement(2277)-g, adbSNP:372482596
complement(2278)-g, adbSNP:368531137
complement(2289)-g, adbSNP:112930313
2323+a, tdbSNP:72659377
complement(2362)-g, adbSNP:374500944
complement(2394)-g, adbSNP:147297927
complement(2452)-dbSNP:
complement(2452)-t, cdbSNP:202214010
complement(2467)-t, cdbSNP:377183051
complement(2471)-t, cdbSNP:143800457
complement(2488)-t, cdbSNP:368579872
complement(2516)-dbSNP:
complement(2516)-g, adbSNP:143763184
complement(2517)-t, cdbSNP:200275059
complement(2555)-t, cdbSNP:200611961
complement(2561)-t, cdbSNP:368869853
complement(2592)-dbSNP:
complement(2592)-t, gdbSNP:144256653
complement(2597)-g, adbSNP:374163967
2611+c, tdbSNP:121909344
2612+a, gdbSNP:72466492
complement(2623)-t, gdbSNP:201592072
complement(2640)-t, gdbSNP:142107482
complement(2642)-t, cdbSNP:377530504
complement(2655)-t, cdbSNP:145150561
complement(2687)-g, cdbSNP:372500630
complement(2688)-g, adbSNP:369101047
complement(2690)-g, cdbSNP:150928856
2706+a, gdbSNP:1130484
complement(2707)-t, gdbSNP:377644081
complement(2750)-dbSNP:
complement(2750)-t, cdbSNP:140485294
complement(2769)-g, adbSNP:377519506
complement(2776)-g, cdbSNP:145293019
complement(2781)-c, adbSNP:199501797
complement(2807)-t, gdbSNP:75213803
2809+c, gdbSNP:72659379
complement(2846)-g, adbSNP:150798076
complement(2863)-g, adbSNP:148511573
complement(2881)-t, cdbSNP:201063854
complement(2901)-dbSNP:
complement(2901)-g, adbSNP:376816962
complement(2904)-g, adbSNP:191073199
complement(2907)-g, adbSNP:140986485
complement(2915)-t, cdbSNP:370085138
complement(2956)-t, cdbSNP:369249351
complement(2972)-g, adbSNP:201949927
2994+c, tdbSNP:72659381
complement(3001)-c, adbSNP:75503452
complement(3005)-t, cdbSNP:375079576
complement(3034)-dbSNP:
complement(3034)-t, gdbSNP:201914453
complement(3052)-g, adbSNP:373818927
complement(3063)-g, cdbSNP:145130328
complement(3093)-t, gdbSNP:138305126
complement(3103)-t, cdbSNP:199780349
complement(3168)-dbSNP:
complement(3168)-g, adbSNP:182000383
complement(3196)-g, adbSNP:370060938
complement(3210)-g, cdbSNP:371241720
complement(3221)-t, adbSNP:376868584
complement(3225)-t, cdbSNP:372554051
complement(3227)-t, cdbSNP:369129714
complement(3231)-g, adbSNP:140969689
complement(3248)-t, cdbSNP:200580530
complement(3261)-g, adbSNP:376031920
complement(3280)-t, cdbSNP:112395789
complement(3333)-dbSNP:
complement(3333)-t, cdbSNP:367898436
complement(3385)-g, adbSNP:140066692
complement(3390)-g, cdbSNP:375157202
complement(3395)-t, cdbSNP:145857843
3404+a, gdbSNP:72659383
complement(3471)-dbSNP:
complement(3471)-t, cdbSNP:202237523
complement(3493)-g, adbSNP:201918007
complement(3513)-t, cdbSNP:148457249
3545+a, gdbSNP:121909345
complement(3565)-g, cdbSNP:374567374
complement(3577)-t, cdbSNP:187434401
complement(3682)-dbSNP:
complement(3682)-c, adbSNP:373738724
complement(3687)-t, cdbSNP:139241420
3733+a, gdbSNP:72466493
complement(3740)-g, adbSNP:376549770
complement(3741)-t, cdbSNP:142030960
complement(3745)-t, cdbSNP:373550911
complement(3754)-t, cdbSNP:375230951
complement(3762)-g, adbSNP:146094433
complement(3766)-t, adbSNP:199669902
complement(3780)-dbSNP:
complement(3780)-g, cdbSNP:148146325
complement(3789)-t, cdbSNP:149440626
complement(3800)-g, adbSNP:145819459
complement(3801)-t, cdbSNP:200834352
complement(3816)-t, cdbSNP:137966704
complement(3823)-g, adbSNP:112571739
complement(3826)-g, adbSNP:369370232
complement(3837)-g, adbSNP:115689748
complement(3869)-dbSNP:
complement(3869)-t, cdbSNP:150386917
complement(3886)-g, cdbSNP:184147813
3931+a, gdbSNP:72466495
complement(3956)-dbSNP:
complement(3956)-t, cdbSNP:200095976
complement(3964)-t, cdbSNP:184429549
complement(3969)-t, cdbSNP:377745224
complement(4042)-t, g, cdbSNP:146083590
complement(4071)-g, adbSNP:374006190
complement(4086)-g, adbSNP:200676625
complement(4092)-g, cdbSNP:377080829
complement(4101)-t, cdbSNP:11555696
complement(4128)-g, adbSNP:371589609
complement(4129)-t, cdbSNP:368049781
complement(4183)-t, cdbSNP:151150356
complement(4185)-g, cdbSNP:185694177
complement(4247)-g, adbSNP:142053202
complement(4319)-g, adbSNP:140263124
4352+a, cdbSNP:17009890
4414+c, tdbSNP:3177776
Gene SymbolDCTN1
Gene SynonymDAP-150; DP-150; P135
Chromosome2
Locus Map2p13
Title DCTN1 mutation analysis in families with progressive supranuclear palsy-like phenotypes .
Author Caroppo P, Le Ber I, Clot F, Rivaud-Pechoux S, Camuzat A, De Septenville A, Boutoleau-Bretonniere C, Mourlon V, Sauvee M, Lebouvier T, Bonnet AM, Levy R, Vercelletto M and Brice A.
Journal JAMA Neurol 71 (2), 208-215 (2014)
Title Characterization of functional domains of human EB1 family proteins .
Author Bu W and Su LK.
Journal J. Biol. Chem. 278 (50), 49721-49731 (2003)
Title Evidence that an interaction between EB1 and p150(Glued) is required for the formation and maintenance of a radial microtubule array anchored at the centrosome .
Author Askham JM, Vaughan KT, Goodson HV and Morrison EE.
Journal Mol. Biol. Cell 13 (10), 3627-3645 (2002)
Title Genomic organization of the DCTN1-SLC4A5 locus encoding both NBC4 and p150(Glued) .
Author Pushkin A, Abuladze N, Newman D, Tatishchev S and Kurtz I.
Journal Cytogenet. Cell Genet. 95 (3-4), 163-168 (2001)
Title The genomic structure of DCTN1, a candidate gene for limb-girdle muscular dystrophy (LGMD2B) .
Author Tokito MK and Holzbaur EL.
Journal Biochim. Biophys. Acta 1442 (2-3), 432-436 (1998)
Title Human DCTN1: genomic structure and evaluation as a candidate for Alstrom syndrome .
Author Collin GB, Nishina PM, Marshall JD and Naggert JK.
Journal Genomics 53 (3), 359-364 (1998)
Title Characterization of the p22 subunit of dynactin reveals the localization of cytoplasmic dynein and dynactin to the midbody of dividing cells .
Author Karki S, LaMonte B and Holzbaur EL.
Journal J. Cell Biol. 142 (4), 1023-1034 (1998)
Title Localization of the DCTN1 gene encoding p150Glued to human chromosome 2p13 by fluorescence in situ hybridization .
Author Holzbaur EL and Tokito MK.
Journal Genomics 31 (3), 398-399 (1996)
Title Perry Syndrome .
Author Wszolek,Z. and Wider,C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Homology of a 150K cytoplasmic dynein-associated polypeptide with the Drosophila gene Glued .
Author Holzbaur EL, Hammarback JA, Paschal BM, Kravit NG, Pfister KK and Vallee RB.
Journal Nature 351 (6327), 579-583 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.