• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lactate dehydrogenase A (LDHA), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18760 Homo sapiens lactate dehydrogenase A (LDHA), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu18760C Homo sapiens lactate dehydrogenase A (LDHA), transcript variant 2, mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001135239.1, 207028493
Length 825 bp
Structure linear
Update Date 13-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens lactate dehydrogenase A (LDHA), transcript variant 2, mRNA.
Product L-lactate dehydrogenase A chain isoform 2
Comment

Summary: The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. [provided by RefSeq, Sep 2008].


Transcript Variant: This variant (2) lacks an in-frame exon in the central coding region, compared to variant 1. The resulting isoform (2) lacks a segment of the LDH domain but has the same N- and C-termini, compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001128711.1
CDS 273..1097
Misc Feature(1)135..137
Misc Feature(2)327..1085
Misc Feature(3)327..1085
Misc Feature(4)order(330..332,639..641,648..650,654..656,705..707,
Misc Feature(5)345..1070
Misc Feature(6)order(357..365,426..428,432..434,441..443,579..581,
Misc Feature(7)order(369..371,384..386,450..455,462..464,468..473,
Misc Feature(8)order(603..605,675..677,810..812,840..842)
Exon (1)1..248
Gene:LDHA
Gene Synonym:GSD11; HEL-S-133P; LDH1; LDHM; PIG19
Exon (2)249..398
Gene:LDHA
Gene Synonym:GSD11; HEL-S-133P; LDH1; LDHM; PIG19
Exon (3)399..516
Gene:LDHA
Gene Synonym:GSD11; HEL-S-133P; LDH1; LDHM; PIG19
Exon (4)517..690
Gene:LDHA
Gene Synonym:GSD11; HEL-S-133P; LDH1; LDHM; PIG19
Exon (5)691..808
Gene:LDHA
Gene Synonym:GSD11; HEL-S-133P; LDH1; LDHM; PIG19
Exon (6)809..932
Gene:LDHA
Gene Synonym:GSD11; HEL-S-133P; LDH1; LDHM; PIG19
Exon (7)933..2034
Gene:LDHA
Gene Synonym:GSD11; HEL-S-133P; LDH1; LDHM; PIG19
Translation MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG EMMDLQHGSLFLRTPKIVSGKVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERL GVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESA YEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQN GISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
25+dbSNP:
25+a, cdbSNP:373189305
105+g, tdbSNP:113277870
114..115+, cdbSNP:371317664
146+c, tdbSNP:369920701
160+c, gdbSNP:200117238
182+a, c, gdbSNP:112306841
184+c, tdbSNP:202100687
204+a, tdbSNP:199895561
209+c, tdbSNP:200916427
215+a, c, tdbSNP:201875891
218+a, gdbSNP:200384555
232+c, tdbSNP:200770616
242+a, cdbSNP:202034923
251+dbSNP:
251+g, tdbSNP:373130532
259+a, gdbSNP:201366589
279+a, gdbSNP:375339263
280+c, tdbSNP:200251957
281+c, tdbSNP:200837378
289+a, gdbSNP:11553873
311+a, cdbSNP:371221146
318+a, gdbSNP:11553866
320+a, gdbSNP:201882573
324+a, gdbSNP:199585928
326+c, tdbSNP:11553865
329+a, c, tdbSNP:11553870
334+a, gdbSNP:144507081
351+a, gdbSNP:11553874
376+c, gdbSNP:200846527
398+a, gdbSNP:148761066
409+dbSNP:
409+a, tdbSNP:201460924
434+c, tdbSNP:200075826
435+a, gdbSNP:144856598
455+a, gdbSNP:149588992
479+c, gdbSNP:202095684
489+a, gdbSNP:191747797
494+a, gdbSNP:201254300
534+dbSNP:
534+a, gdbSNP:200268273
537+g, tdbSNP:116841148
543+a, g, tdbSNP:145506651
552+c, gdbSNP:138120080
568+a, gdbSNP:368815124
581+c, g, tdbSNP:5030621
603+c, tdbSNP:201372985
617+a, g, tdbSNP:4820
636+g, tdbSNP:200586792
645+g, tdbSNP:199659698
646+c, tdbSNP:200566403
655+a, gdbSNP:148186234
666+c, tdbSNP:201252408
675+c, tdbSNP:190552648
677+c, tdbSNP:200519855
692+dbSNP:
692+c, gdbSNP:373534867
706+c, gdbSNP:34305721
708+a, gdbSNP:370781767
770+a, gdbSNP:199918200
794+c, gdbSNP:141158742
802+c, tdbSNP:150740870
830+dbSNP:
830+c, tdbSNP:201227737
875+a, gdbSNP:137996815
906+g, tdbSNP:371400978
908+a, gdbSNP:187005834
922+c, tdbSNP:200256380
923+a, cdbSNP:367553288
941+dbSNP:
941+c, tdbSNP:143206293
942+a, gdbSNP:199859192
952+a, tdbSNP:147520495
990+a, cdbSNP:201721233
1017+a, cdbSNP:368105451
1041+c, tdbSNP:200093825
1042+a, gdbSNP:140090654
1049+a, gdbSNP:145889467
1052+a, gdbSNP:12790695
1059+a, gdbSNP:200019907
1060+a, gdbSNP:200908475
1072+g, tdbSNP:201842179
1083+g, tdbSNP:121912479
1112+a, gdbSNP:200383424
1138+c, tdbSNP:377516196
1181+a, gdbSNP:200810272
1183+c, tdbSNP:138352370
1186+c, tdbSNP:200441639
1198+c, tdbSNP:201713804
1199+a, gdbSNP:199526012
1203+c, tdbSNP:200389286
1211+g, tdbSNP:201359330
1226+a, gdbSNP:199722017
1233+a, cdbSNP:200833510
1289+a, gdbSNP:11553862
1318+a, gdbSNP:201661015
1340+c, gdbSNP:76818137
1352+a, gdbSNP:200774396
1370+c, tdbSNP:202048658
1371+a, gdbSNP:200172020
1385+c, gdbSNP:200772587
1407+c, tdbSNP:201495225
1408+c, tdbSNP:200079157
1409+a, gdbSNP:200982215
1418+a, gdbSNP:201933139
1419+c, tdbSNP:200397839
1448+c, tdbSNP:201101330
1465+a, cdbSNP:14790
1476+a, cdbSNP:202218269
1519+c, tdbSNP:14789
1551+c, gdbSNP:200436948
1553+a, gdbSNP:201297054
1563+c, tdbSNP:199655216
1581+a, gdbSNP:200335252
1584+a, gdbSNP:201742561
1604+a, gdbSNP:199522034
1626+c, tdbSNP:200727123
1628+c, tdbSNP:201419761
1630+a, cdbSNP:199757663
1651+c, tdbSNP:200718851
1679+c, tdbSNP:144317385
1688+a, cdbSNP:199957616
1701+a, tdbSNP:148774730
1706+g, tdbSNP:143493256
1719+a, gdbSNP:3758681
1736+c, tdbSNP:3758682
1817+c, gdbSNP:3758683
1857..1859+, tatdbSNP:59010595
1859+g, tdbSNP:189063205
2011+a, gdbSNP:147174554
Gene SymbolLDHA
Gene SynonymGSD11; HEL-S-133P; LDH1; LDHM; PIG19
Chromosome11
Locus Map11p15.4
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001165416 Homo sapiens lactate dehydrogenase A (LDHA), transcript variant 5, mRNA. On-demand $159.00 7-9
NM_001135239 Homo sapiens lactate dehydrogenase A (LDHA), transcript variant 2, mRNA. On-demand $159.00 7-9
NM_001165415 Homo sapiens lactate dehydrogenase A (LDHA), transcript variant 4, mRNA. On-demand $159.00 7-9
NM_001165414 Homo sapiens lactate dehydrogenase A (LDHA), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_005566 Homo sapiens lactate dehydrogenase A (LDHA), transcript variant 1, mRNA. In-stock $99.00 5-7
Title Attenuation of LDHA expression in cancer cells leads to redox-dependent alterations in cytoskeletal structure and cell migration .
Author Arseneault R, Chien A, Newington JT, Rappon T, Harris R and Cumming RC.
Journal Cancer Lett. 338 (2), 255-266 (2013)
Title Galloflavin suppresses lactate dehydrogenase activity and causes .
Author Vettraino M, Manerba M, Govoni M and Di Stefano G.
Journal Anticancer Drugs 24 (8), 862-870 (2013)
Title Low expression of dendritic cell-specific intercellular adhesion molecule-grabbing nonintegrin-related protein in non-Hodgkin lymphoma and significant correlations with lactic acid dehydrogenase and beta2-microglobulin .
Author Zhang Z, Chen K, Yan L, Yang Z, Zhu Z, Chen C, Zeng J, Wei W, Qi X, Ren S and Zuo Y.
Journal Biochem. Cell Biol. 91 (4), 214-220 (2013)
Title Evaluation of LDH-A and glutaminase inhibition in vivo by hyperpolarized 13C-pyruvate magnetic resonance spectroscopy of tumors .
Author Dutta P, Le A, Vander Jagt DL, Tsukamoto T, Martinez GV, Dang CV and Gillies RJ.
Journal Cancer Res. 73 (14), 4190-4195 (2013)
Title Estrogen-related receptor alpha modulates lactate dehydrogenase activity in thyroid tumors .
Author Mirebeau-Prunier D, Le Pennec S, Jacques C, Fontaine JF, Gueguen N, Boutet-Bouzamondo N, Donnart A, Malthiery Y and Savagner F.
Journal PLoS ONE 8 (3), E58683 (2013)
Title [Gene expression in lactate dehydrogenase-A subunit deficiency] .
Author Miyajima H, Shimizu T and Kaneko E.
Journal Rinsho Shinkeigaku 32 (10), 1087-1092 (1992)
Title Molecular analysis of genetic mutation in electrophoretic variant of human lactate dehydrogenase-A(M) subunit .
Author Sudo K, Maekawa M, Shioya M, Ikeda K, Takahashi N, Isogai Y, Li SS, Kanno T, Machida K and Toriumi J.
Journal Biochem. Int. 27 (6), 1051-1057 (1992)
Title Genotypic analysis of families with lactate dehydrogenase A (M) deficiency by selective DNA amplification .
Author Maekawa M, Sudo K, Li SS and Kanno T.
Journal Hum. Genet. 88 (1), 34-38 (1991)
Title Analysis of genetic mutations in human lactate dehydrogenase-A(M) deficiency using DNA conformation polymorphism in combination with polyacrylamide gradient gel and silver staining .
Author Maekawa M, Sudo K, Li SS and Kanno T.
Journal Biochem. Biophys. Res. Commun. 180 (2), 1083-1090 (1991)
Title Rhabdomyosarcoma-associated locus and MYOD1 are syntenic but separate loci on the short arm of human chromosome 11 .
Author Scrable HJ, Johnson DK, Rinchik EM and Cavenee WK.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (6), 2182-2186 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.