• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens calcium binding and coiled-coil domain 1 (CALCOCO1), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_001143682 Homo sapiens calcium binding and coiled-coil domain 1 (CALCOCO1), transcript variant 2, mRNA. ORF Sequence $528.09
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001143682.1, 219521892
Length 2790 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens calcium binding and coiled-coil domain 1 (CALCOCO1), transcript variant 2, mRNA.
Product calcium-binding and coiled-coil domain-containing protein 1 isoform 2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DB060684.1, AK122773.1 and BC003177.1.


Transcript Variant: This variant (2) omits an inframe coding exon and uses an alternate (in-frame) splice acceptor site, compared to variant 2. This results in a shorter protein (isoform 2).


##Evidence-Data-START## Transcript exon combination :: AK122773.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025088 [ECO:0000350] ##Evidence-Data-END##

RefSeq NP_001137154.1
CDS 145..1965
Misc Feature(1)106..108
Misc Feature(2)169..1656
Misc Feature(3)169..1656
Exon (1)1..120
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (2)121..300
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (3)301..403
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (4)404..495
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (5)496..654
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (6)655..803
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (7)804..894
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (8)895..1149
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (9)1150..1275
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (10)1276..1371
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (11)1372..1480
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (12)1481..1680
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (13)1681..1787
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Exon (14)1788..2790
Gene:CALCOCO1
Gene Synonym:calphoglin; Cocoa; PP13275
Translation MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRD YHTFVWSSVPESTTDGSPIHTSVQFQEPRPMDELVTLEEADGGSDILLVVPKATVLQNQL DESQQERNDLMQLKLQLEGQVTELRSRVQELERALATARQEHTELMEQYKGISRSHGEIT EERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKALTREQEKLLGQLK EVQADKEQSEAELEPLKEQLRGAQELAASSQQKATLLGEELASAAAARDRTIAELHRSRL EVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVEAEKDKILKLSAEILRLEKAVQEERT QNQVFKTELAREKDSSLVQLSESKRELTELRSALRVLQKEKEQLQEEKQELLEYMRKLEA RLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSEDESPEDMRLPPYGLCERGDPGSSPA GPREASPLVVISQPAPISPHLSGPAEDSSSDSEAEDEKSVLMAAVQSGGEEANLLLPELG SAFYDMASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFFFSTQ DPFTFE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(17..18)-dbSNP:
complement(17..18)-, tdbSNP:34077073
complement(166)-g, adbSNP:145201013
complement(167)-t, cdbSNP:149998353
complement(179)-t, cdbSNP:78731604
complement(205)-t, cdbSNP:199534314
complement(209)-t, cdbSNP:201880686
complement(349)-dbSNP:
complement(349)-t, cdbSNP:36049232
complement(371)-c, adbSNP:143196126
complement(377)-g, cdbSNP:140950548
complement(378)-t, gdbSNP:147319053
complement(424)-dbSNP:
complement(424)-g, adbSNP:150297343
complement(504)-dbSNP:
complement(504)-g, adbSNP:144391784
complement(523)-g, adbSNP:35358749
complement(559)-t, cdbSNP:137978368
complement(584)-t, cdbSNP:150332172
complement(588)-t, cdbSNP:77035073
complement(597)-g, adbSNP:140533973
complement(598)-t, cdbSNP:201999937
complement(620)-c, adbSNP:201309784
complement(632)-g, adbSNP:146731373
complement(633)-t, cdbSNP:144845004
complement(656)-dbSNP:
complement(656)-t, cdbSNP:202168855
complement(690)-t, cdbSNP:141123140
complement(697)-t, cdbSNP:151023884
complement(706)-g, adbSNP:142792723
complement(712)-g, adbSNP:148517395
complement(736)-g, adbSNP:200082026
complement(753)-g, adbSNP:148746301
complement(854)-dbSNP:
complement(854)-t, cdbSNP:139754676
complement(873)-t, cdbSNP:199970445
complement(906)-dbSNP:
complement(906)-t, cdbSNP:201345561
complement(993)-t, cdbSNP:3741658
complement(1000)-t, cdbSNP:199775097
complement(1007)-t, cdbSNP:139410017
complement(1012)-g, adbSNP:150916206
complement(1019)-g, adbSNP:113333236
complement(1050)-g, cdbSNP:141619903
complement(1067)-g, adbSNP:3741659
complement(1092)-t, cdbSNP:146203542
complement(1127)-g, adbSNP:141651531
complement(1164)-dbSNP:
complement(1164)-c, adbSNP:138639329
complement(1187)-t, adbSNP:200012009
complement(1195)-g, adbSNP:144779779
complement(1259)-t, cdbSNP:34311341
complement(1275)-t, cdbSNP:201669775
complement(1295)-dbSNP:
complement(1295)-t, gdbSNP:200408324
complement(1310)-t, gdbSNP:138081916
complement(1325)-g, adbSNP:199564380
complement(1328)-t, cdbSNP:201677567
complement(1444)-dbSNP:
complement(1444)-t, cdbSNP:201872065
complement(1468)-t, cdbSNP:115704643
complement(1471)-g, cdbSNP:201565487
complement(1497)-dbSNP:
complement(1497)-t, cdbSNP:200742427
complement(1503)-g, cdbSNP:140431811
complement(1566)-g, cdbSNP:202198086
complement(1568)-g, cdbSNP:116674128
complement(1571)-c, adbSNP:34229062
complement(1656)-t, cdbSNP:144266090
complement(1662)-t, cdbSNP:199692489
complement(1680)-t, cdbSNP:200862370
complement(1804)-dbSNP:
complement(1804)-t, gdbSNP:34281379
complement(1825)-t, cdbSNP:201789372
complement(1844)-t, gdbSNP:145546799
complement(1934)-, adbSNP:143101583
complement(1966)-t, g, adbSNP:113122716
complement(1978)-t, cdbSNP:200533485
complement(1997)-g, cdbSNP:201037935
complement(2068)-, gdbSNP:34933450
complement(2152)-g, cdbSNP:184795396
complement(2155)-c, adbSNP:192377832
complement(2178)-g, adbSNP:142911391
complement(2179)-t, cdbSNP:148552416
complement(2262)-t, cdbSNP:144794774
complement(2389)-g, adbSNP:186697244
complement(2519)-g, adbSNP:142730902
complement(2575..2576)-, adbSNP:71661048
complement(2586)-g, adbSNP:138726915
complement(2607)-t, cdbSNP:182375472
complement(2619)-g, adbSNP:3741662
complement(2655)-t, cdbSNP:61098175
complement(2676..2677)-, gdbSNP:34019749
complement(2696)-g, cdbSNP:115444823
complement(2733)-t, cdbSNP:192924214
complement(2768)-t, cdbSNP:188174764
Gene SymbolCALCOCO1
Gene Synonymcalphoglin; Cocoa; PP13275
Chromosome12
Locus Map12q13.13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001143682 Homo sapiens calcium binding and coiled-coil domain 1 (CALCOCO1), transcript variant 2, mRNA. Full Length $809.10
ORF Sequence $528.09
NM_020898 Homo sapiens calcium binding and coiled-coil domain 1 (CALCOCO1), transcript variant 1, mRNA. Full Length $1066.10
ORF Sequence $602.04
Title Genome-wide association study of panic disorder in the Japanese population .
Author Otowa,T., Yoshida,E., Sugaya,N., Yasuda,S., Nishimura,Y., Inoue,K., Tochigi,M., Umekage,T., Miyagawa,T., Nishida,N., Tokunaga,K., Tanii,H., Sasaki,T., Kaiya,H. and Okazaki,Y.
Journal J. Hum. Genet. 54 (2), 122-126 (2009)
Title Screening and association testing of common coding variation in steroid hormone receptor co-activator and co-repressor genes in relation to breast cancer risk: the Multiethnic Cohort .
Author Haiman,C.A., Garcia,R.R., Hsu,C., Xia,L., Ha,H., Sheng,X., Le Marchand,L., Kolonel,L.N., Henderson,B.E., Stallcup,M.R., Greene,G.L. and Press,M.F.
Journal BMC Cancer 9, 43 (2009)
Title Role of the N-terminal activation domain of the coiled-coil coactivator in mediating transcriptional activation by beta-catenin .
Author Yang,C.K., Kim,J.H. and Stallcup,M.R.
Journal Mol. Endocrinol. 20 (12), 3251-3262 (2006)
Title A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration .
Author Lim,J., Hao,T., Shaw,C., Patel,A.J., Szabo,G., Rual,J.F., Fisk,C.J., Li,N., Smolyar,A., Hill,D.E., Barabasi,A.L., Vidal,M. and Zoghbi,H.Y.
Journal Cell 125 (4), 801-814 (2006)
Title Differential use of functional domains by coiled-coil coactivator in its synergistic coactivator function with beta-catenin or GRIP1 .
Author Yang,C.K., Kim,J.H., Li,H. and Stallcup,M.R.
Journal J. Biol. Chem. 281 (6), 3389-3397 (2006)
Title The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts .
Author Ozyildirim,A.M., Wistow,G.J., Gao,J., Wang,J., Dickinson,D.P., Frierson,H.F. Jr. and Laurie,G.W.
Journal Invest. Ophthalmol. Vis. Sci. 46 (5), 1572-1580 (2005)
Title Cellular signaling mediated by calphoglin-induced activation of IPP and PGM .
Author Takahashi,K., Inuzuka,M. and Ingi,T.
Journal Biochem. Biophys. Res. Commun. 325 (1), 203-214 (2004)
Title The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment .
Author Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J., Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B., Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E., Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S., Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C., Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V., Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K., Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z., Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
Journal Genome Res. 13 (10), 2265-2270 (2003)
Title Immunomic analysis of human sarcoma .
Author Lee,S.Y., Obata,Y., Yoshida,M., Stockert,E., Williamson,B., Jungbluth,A.A., Chen,Y.T., Old,L.J. and Scanlan,M.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 100 (5), 2651-2656 (2003)
Title Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing .
Author Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and Wiemann,S.
Journal EMBO Rep. 1 (3), 287-292 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878