• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens SMAD family member 3 (SMAD3), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001145103 Homo sapiens SMAD family member 3 (SMAD3), transcript variant 3, mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_001145103.1, 223029441
Length 5808 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens SMAD family member 3 (SMAD3), transcript variant 3, mRNA.
Product mothers against decapentaplegic homolog 3 isoform 3
Comment

Summary: The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq, Apr 2009].


Transcript Variant: This variant (3) differs in the 5' UTR and coding sequence compared to variant 1. The resulting isoform (3) has a shorter and distinct N-terminus compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001138575.1
CDS 7..1152
Misc Feature(1)<79..270
Misc Feature(2)<79..270
Misc Feature(3)order(94..99,172..174)
Misc Feature(4)order(199..201,235..237,250..252)
Misc Feature(5)544..1116
Misc Feature(6)order(595..597,610..615,619..621,652..666,676..678,
Exon (1)1..80
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (2)81..274
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (3)275..406
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (4)407..481
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (5)482..532
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (6)533..745
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (7)746..883
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (8)884..1028
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (9)1029..5808
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Translation MSCLHPRQTWKGAALVHRKAWWMGRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELR AMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENT NFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPV TYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVE LTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFN NQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPL QWLDKVLTQMGSPSIRCSSVS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
183+dbSNP:
183+a, gdbSNP:1065080
190+a, gdbSNP:138550573
315+a, gdbSNP:140275295
331+c, tdbSNP:145380987
357+c, tdbSNP:202203039
375+c, tdbSNP:138395233
382+a, gdbSNP:35874463
487+dbSNP:
487+c, tdbSNP:150682850
510+a, gdbSNP:202094530
561+dbSNP:
561+a, gdbSNP:138940179
588+c, tdbSNP:149443777
597+c, tdbSNP:144667334
615+a, tdbSNP:201614771
621+c, tdbSNP:139907582
651+c, tdbSNP:145414319
744+c, tdbSNP:117185005
759+dbSNP:
759+a, gdbSNP:139616052
764+a, cdbSNP:142620875
858+a, gdbSNP:150994304
879+a, cdbSNP:34188464
906+dbSNP:
906+a, cdbSNP:202098340
944+a, gdbSNP:140880290
999+c, tdbSNP:144245324
1096+dbSNP:
1096+g, tdbSNP:201263330
1119+c, tdbSNP:146659831
1177+c, gdbSNP:189249001
1182+c, gdbSNP:201206131
1217+c, tdbSNP:182280596
1317+c, tdbSNP:111695641
1387+a, gdbSNP:79827660
1394+c, tdbSNP:56036573
1395+a, gdbSNP:115213021
1443+a, gdbSNP:146287966
1453+c, tdbSNP:72661159
1470+a, gdbSNP:79368607
1554+c, tdbSNP:8025774
1571+g, tdbSNP:78329172
1662..1693+, ccccgccccaccactccagcagaccttgccccdbSNP:55978804
1817+a, tdbSNP:186841203
1930+c, gdbSNP:78383292
1941+a, gdbSNP:191679355
1950+a, gdbSNP:138327222
1995+a, gdbSNP:55970514
2069+a, tdbSNP:181289276
2126+a, gdbSNP:186538259
2146+a, gdbSNP:190014997
2170+a, cdbSNP:142827677
2257+a, gdbSNP:8031440
2333+c, tdbSNP:72661160
2348+a, gdbSNP:142609762
2369+a, gdbSNP:150600147
2382+c, gdbSNP:112747060
2397+a, gdbSNP:8031627
2418+c, tdbSNP:1061341
2477+c, tdbSNP:139620908
2501+g, tdbSNP:182242274
2575+a, gdbSNP:2278670
2694+c, tdbSNP:28363812
2851+c, gdbSNP:188001329
2949..2952+, gacadbSNP:141408841
2957+c, tdbSNP:191114875
3032+c, tdbSNP:144205938
3165+c, tdbSNP:183913368
3229+c, tdbSNP:113309733
3230+a, gdbSNP:147761102
3264+a, gdbSNP:115307123
3379+a, gdbSNP:11638476
3381+a, gdbSNP:188412401
3394+a, gdbSNP:117707762
3434+c, tdbSNP:12595334
3436+c, tdbSNP:139575773
3437+c, gdbSNP:62014609
3511+c, tdbSNP:193013035
3596+a, gdbSNP:145102966
3641+c, tdbSNP:80226876
3699+c, tdbSNP:72661161
3700+a, gdbSNP:186967388
3878+c, tdbSNP:191410394
3899+c, tdbSNP:112868185
3945+c, tdbSNP:3743342
4042+c, gdbSNP:149202238
4100+c, tdbSNP:183703685
4109+c, gdbSNP:143339480
4112+c, gdbSNP:151326457
4114+c, tdbSNP:188022958
4120+a, gdbSNP:28613415
4147+a, gdbSNP:140694679
4189+c, gdbSNP:145645018
4208+a, cdbSNP:111386789
4212..4214+, gagdbSNP:3833027
4214+a, gdbSNP:76820462
4214+, gagdbSNP:72531941
4275+c, tdbSNP:62014610
4276+a, gdbSNP:138185890
4308+, tdbSNP:72350428
4352+c, tdbSNP:142744440
4353+a, gdbSNP:11556089
4374+a, gdbSNP:182172002
4431+a, gdbSNP:185512187
4514+c, tdbSNP:77620237
4536+c, tdbSNP:138798418
4606+a, gdbSNP:190177128
4614+a, gdbSNP:181812913
4658+a, gdbSNP:11556090
4693+g, tdbSNP:185838563
4702+c, gdbSNP:61740807
4703+a, gdbSNP:190155838
4807+a, gdbSNP:143991135
4865+c, tdbSNP:12900401
4909+a, gdbSNP:140620343
5050+c, tdbSNP:3743343
5104+c, gdbSNP:142857253
5122+c, tdbSNP:1052488
5149+c, gdbSNP:28473647
5259+a, gdbSNP:200460714
5313+g, tdbSNP:199952886
5359+c, tdbSNP:181158603
5484+c, gdbSNP:75971163
5550+c, tdbSNP:72661162
5554+a, gdbSNP:185374880
5591+c, tdbSNP:189685754
5656+c, tdbSNP:183877342
Gene SymbolSMAD3
Gene SynonymHSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Chromosome15
Locus Map15q22.33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001145102 Homo sapiens SMAD family member 3 (SMAD3), transcript variant 2, mRNA. In-stock $418.00 $369.00 10
NM_001145103 Homo sapiens SMAD family member 3 (SMAD3), transcript variant 3, mRNA. On-demand $549.00 14
NM_001145104 Homo sapiens SMAD family member 3 (SMAD3), transcript variant 4, mRNA. In-stock $308.00 $259.00 10
NM_005902 Homo sapiens SMAD family member 3 (SMAD3), transcript variant 1, mRNA. On-demand $699.00 18
Title SMAD2, SMAD3 and SMAD4 mutations in colorectal cancer .
Author Fleming,N.I., Jorissen,R.N., Mouradov,D., Christie,M., Sakthianandeswaren,A., Palmieri,M., Day,F., Li,S., Tsui,C., Lipton,L., Desai,J., Jones,I.T., McLaughlin,S., Ward,R.L., Hawkins,N.J., Ruszkiewicz,A.R., Moore,J., Zhu,H.J., Mariadason,J.M., Burgess,A.W., Busam,D., Zhao,Q., Strausberg,R.L., Gibbs,P. and Sieber,O.M.
Journal Cancer Res. 73 (2), 725-735 (2013)
Title Smad3 linker phosphorylation attenuates Smad3 transcriptional activity and TGF-beta1/Smad3-induced epithelial-mesenchymal transition in renal epithelial cells .
Author Bae,E., Kim,S.J., Hong,S., Liu,F. and Ooshima,A.
Journal Biochem. Biophys. Res. Commun. 427 (3), 593-599 (2012)
Title CCL2/CCR2 chemokine signaling coordinates survival and motility of breast cancer cells through Smad3 protein- and p42/44 mitogen-activated protein kinase (MAPK)-dependent mechanisms .
Author Fang,W.B., Jokar,I., Zou,A., Lambert,D., Dendukuri,P. and Cheng,N.
Journal J. Biol. Chem. 287 (43), 36593-36608 (2012)
Title Dimethylfumarate attenuates renal fibrosis via NF-E2-related factor 2-mediated inhibition of transforming growth factor-beta/Smad signaling .
Author Oh,C.J., Kim,J.Y., Choi,Y.K., Kim,H.J., Jeong,J.Y., Bae,K.H., Park,K.G. and Lee,I.K.
Journal PLoS ONE 7 (10), E45870 (2012)
Title Differential regulation of Smad3 and of the type II transforming growth factor-beta receptor in mitosis: implications for signaling .
Author Hirschhorn,T., Barizilay,L., Smorodinsky,N.I. and Ehrlich,M.
Journal PLoS ONE 7 (8), E43459 (2012)
Title Heteromeric and homomeric interactions correlate with signaling activity and functional cooperativity of Smad3 and Smad4/DPC4 .
Author Wu,R.Y., Zhang,Y., Feng,X.H. and Derynck,R.
Journal Mol. Cell. Biol. 17 (5), 2521-2528 (1997)
Title Receptor-associated Mad homologues synergize as effectors of the TGF-beta response .
Author Zhang,Y., Feng,X., We,R. and Derynck,R.
Journal Nature 383 (6596), 168-172 (1996)
Title Mad-related genes in the human .
Author Riggins,G.J., Thiagalingam,S., Rozenblum,E., Weinstein,C.L., Kern,S.E., Hamilton,S.R., Willson,J.K., Markowitz,S.D., Kinzler,K.W. and Vogelstein,B.
Journal Nat. Genet. 13 (3), 347-349 (1996)
Title E2F-4, a new member of the E2F gene family, has oncogenic activity and associates with p107 in vivo .
Author Beijersbergen,R.L., Kerkhoven,R.M., Zhu,L., Carlee,L., Voorhoeve,P.M. and Bernards,R.
Journal Genes Dev. 8 (22), 2680-2690 (1994)
Title E2F-4, a new member of the E2F transcription factor family, interacts with p107 .
Author Ginsberg,D., Vairo,G., Chittenden,T., Xiao,Z.X., Xu,G., Wydner,K.L., DeCaprio,J.A., Lawrence,J.B. and Livingston,D.M.
Journal Genes Dev. 8 (22), 2665-2679 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.