• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens SMAD family member 3 (SMAD3), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001145103 Homo sapiens SMAD family member 3 (SMAD3), transcript variant 3, mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_001145103.1, 223029441
Length 5808 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens SMAD family member 3 (SMAD3), transcript variant 3, mRNA.
Product mothers against decapentaplegic homolog 3 isoform 3
Comment

Summary: The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq, Apr 2009].


Transcript Variant: This variant (3) differs in the 5' UTR and coding sequence compared to variant 1. The resulting isoform (3) has a shorter and distinct N-terminus compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001138575.1
CDS 7..1152
Misc Feature(1)<79..270
Misc Feature(2)<79..270
Misc Feature(3)order(94..99,172..174)
Misc Feature(4)order(199..201,235..237,250..252)
Misc Feature(5)544..1116
Misc Feature(6)order(595..597,610..615,619..621,652..666,676..678,
Exon (1)1..80
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (2)81..274
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (3)275..406
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (4)407..481
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (5)482..532
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (6)533..745
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (7)746..883
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (8)884..1028
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Exon (9)1029..5808
Gene:SMAD3
Gene Synonym:HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Translation MSCLHPRQTWKGAALVHRKAWWMGRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELR AMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENT NFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPV TYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVE LTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFN NQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPL QWLDKVLTQMGSPSIRCSSVS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
183+dbSNP:
183+a, gdbSNP:1065080
190+a, gdbSNP:138550573
209+c, tdbSNP:387906854
215+a, gdbSNP:369221296
268+a, gdbSNP:371876622
314+c, tdbSNP:377026877
315+a, gdbSNP:140275295
329+a, cdbSNP:375574124
331+c, tdbSNP:145380987
357+c, tdbSNP:202203039
369+c, tdbSNP:374111837
375+c, tdbSNP:138395233
382+a, gdbSNP:35874463
384+c, tdbSNP:375925515
462+dbSNP:
462+a, gdbSNP:368710091
487+dbSNP:
487+c, tdbSNP:150682850
510+a, gdbSNP:202094530
518+c, gdbSNP:376353913
561+dbSNP:
561+a, gdbSNP:138940179
588+c, tdbSNP:149443777
589+a, gdbSNP:387906853
597+c, tdbSNP:144667334
615+a, tdbSNP:201614771
618+c, tdbSNP:376023379
621+c, tdbSNP:139907582
651+c, tdbSNP:145414319
656+c, tdbSNP:387906851
657+c, tdbSNP:370620091
662+c, tdbSNP:387906855
710+a, gdbSNP:387906852
733+c, tdbSNP:387906850
744+c, tdbSNP:117185005
759+dbSNP:
759+a, gdbSNP:139616052
764+a, cdbSNP:142620875
858+a, gdbSNP:150994304
879+a, cdbSNP:34188464
906+dbSNP:
906+a, cdbSNP:202098340
944+a, gdbSNP:140880290
955+g, tdbSNP:387906856
994+a, gdbSNP:370394986
999+c, tdbSNP:144245324
1089+dbSNP:
1089+c, gdbSNP:375243021
1096+g, tdbSNP:201263330
1104+a, cdbSNP:375738035
1119+c, tdbSNP:146659831
1177+c, gdbSNP:189249001
1182+c, gdbSNP:201206131
1203+c, gdbSNP:368655036
1217+c, tdbSNP:182280596
1317+c, tdbSNP:111695641
1387+a, gdbSNP:79827660
1394+c, tdbSNP:56036573
1395+a, gdbSNP:115213021
1443+a, gdbSNP:146287966
1453+c, tdbSNP:72661159
1470+a, gdbSNP:79368607
1554+c, tdbSNP:8025774
1571+g, tdbSNP:78329172
1655+c, tdbSNP:369493674
1662..1693+, ccccgccccaccactccagcagaccttgccccdbSNP:55978804
1817+a, tdbSNP:186841203
1930+c, gdbSNP:78383292
1941+a, gdbSNP:191679355
complement(1950)-g, adbSNP:138327222
1995+a, gdbSNP:55970514
2069+a, tdbSNP:181289276
2126+a, gdbSNP:186538259
2146+a, gdbSNP:190014997
2170+a, cdbSNP:142827677
2257+a, gdbSNP:8031440
2333+c, tdbSNP:72661160
2348+a, gdbSNP:142609762
2369+a, gdbSNP:150600147
2382+c, gdbSNP:112747060
2397+a, gdbSNP:8031627
2418+c, tdbSNP:1061341
complement(2477)-t, cdbSNP:139620908
2501+g, tdbSNP:182242274
2573+c, tdbSNP:372217473
complement(2575)-g, adbSNP:2278670
2694+c, tdbSNP:28363812
2851+c, gdbSNP:188001329
2929..2930+, cctdbSNP:369386357
2949..2952+, gacadbSNP:141408841
2957+c, tdbSNP:191114875
3032+c, tdbSNP:144205938
3165+c, tdbSNP:183913368
3194+c, tdbSNP:368370773
3229+c, tdbSNP:113309733
3230+a, gdbSNP:147761102
3264+a, gdbSNP:115307123
3379+a, gdbSNP:11638476
3381+a, gdbSNP:188412401
3394+a, gdbSNP:117707762
3434+c, tdbSNP:12595334
3436+c, tdbSNP:139575773
3437+c, gdbSNP:62014609
3511+c, tdbSNP:193013035
complement(3596)-g, adbSNP:145102966
3603+c, tdbSNP:372633359
3641+c, tdbSNP:80226876
3699+c, tdbSNP:72661161
3700+a, gdbSNP:186967388
3878+c, tdbSNP:191410394
3899+c, tdbSNP:112868185
3945+c, tdbSNP:3743342
4042+c, gdbSNP:149202238
4100+c, tdbSNP:183703685
4109+c, gdbSNP:143339480
4112+c, gdbSNP:151326457
4114+c, tdbSNP:188022958
4120+a, gdbSNP:28613415
complement(4147)-g, adbSNP:140694679
4189+c, gdbSNP:145645018
4208+a, cdbSNP:111386789
4212..4214+, gagdbSNP:3833027
4212..4214+, gagdbSNP:397772980
4214+a, gdbSNP:76820462
4214+, gagdbSNP:398118956
4275+c, tdbSNP:62014610
4276+a, gdbSNP:138185890
complement(4352)-t, cdbSNP:142744440
4353+a, gdbSNP:11556089
4374+a, gdbSNP:182172002
4431+a, gdbSNP:185512187
4469..4470+, adbSNP:375106285
complement(4514)-t, cdbSNP:77620237
4536+c, tdbSNP:138798418
4606+a, gdbSNP:190177128
4614+a, gdbSNP:181812913
4658+a, gdbSNP:11556090
4693+g, tdbSNP:185838563
complement(4702)-g, cdbSNP:61740807
4703+a, gdbSNP:190155838
4770+a, gdbSNP:373340382
4807+a, gdbSNP:143991135
4865+c, tdbSNP:12900401
4909+a, gdbSNP:140620343
5050+c, tdbSNP:3743343
5104+c, gdbSNP:142857253
5122+c, tdbSNP:1052488
5149+c, gdbSNP:28473647
5259+a, gdbSNP:200460714
5313+g, tdbSNP:199952886
5359+c, tdbSNP:181158603
5484+c, gdbSNP:75971163
5550+c, tdbSNP:72661162
5554+a, gdbSNP:185374880
5591+c, tdbSNP:189685754
5656+c, tdbSNP:183877342
Gene SymbolSMAD3
Gene SynonymHSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3
Chromosome15
Locus Map15q22.33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005902 Homo sapiens SMAD family member 3 (SMAD3), transcript variant 1, mRNA. On-demand $699.00 18
NM_001145104 Homo sapiens SMAD family member 3 (SMAD3), transcript variant 4, mRNA. In-stock $308.00 $259.00 10
NM_001145102 Homo sapiens SMAD family member 3 (SMAD3), transcript variant 2, mRNA. In-stock $418.00 $369.00 10
NM_001145103 Homo sapiens SMAD family member 3 (SMAD3), transcript variant 3, mRNA. On-demand $549.00 14
XM_006720506 PREDICTED: Homo sapiens SMAD family member 3 (SMAD3), transcript variant X1, mRNA. On-demand $549.00 14
Title Reversible phospho-Smad3 signalling between tumour suppression and fibrocarcinogenesis in chronic hepatitis B infection .
Author Deng YR, Yoshida K, Jin QL, Murata M, Yamaguchi T, Tsuneyama K, Moritoki Y, Niu JQ, Matsuzaki K and Lian ZX.
Journal Clin. Exp. Immunol. 176 (1), 102-111 (2014)
Title Smad and NFAT pathways cooperate to induce CD103 expression in human CD8 T lymphocytes .
Author Mokrani M, Klibi J, Bluteau D, Bismuth G and Mami-Chouaib F.
Journal J. Immunol. 192 (5), 2471-2479 (2014)
Title Sustained activation of SMAD3/SMAD4 by FOXM1 promotes TGF-beta-dependent cancer metastasis .
Author Xue,J., Lin,X., Chiu,W.T., Chen,Y.H., Yu,G., Liu,M., Feng,X.H., Sawaya,R., Medema,R.H., Hung,M.C. and Huang,S.
Journal J. Clin. Invest. 124 (2), 564-579 (2014)
Title TGF-beta promotes glioma cell growth via activating Nodal expression through Smad and ERK1/2 pathways .
Author Sun J, Liu SZ, Lin Y, Cao XP and Liu JM.
Journal Biochem. Biophys. Res. Commun. 443 (3), 1066-1072 (2014)
Title Receptor-associated Mad homologues synergize as effectors of the TGF-beta response .
Author Zhang Y, Feng X, We R and Derynck R.
Journal Nature 383 (6596), 168-172 (1996)
Title Mad-related genes in the human .
Author Riggins GJ, Thiagalingam S, Rozenblum E, Weinstein CL, Kern SE, Hamilton SR, Willson JK, Markowitz SD, Kinzler KW and Vogelstein B.
Journal Nat. Genet. 13 (3), 347-349 (1996)
Title E2F-4, a new member of the E2F gene family, has oncogenic activity and associates with p107 in vivo .
Author Beijersbergen RL, Kerkhoven RM, Zhu L, Carlee L, Voorhoeve PM and Bernards R.
Journal Genes Dev. 8 (22), 2680-2690 (1994)
Title E2F-4, a new member of the E2F transcription factor family, interacts with p107 .
Author Ginsberg D, Vairo G, Chittenden T, Xiao ZX, Xu G, Wydner KL, DeCaprio JA, Lawrence JB and Livingston DM.
Journal Genes Dev. 8 (22), 2665-2679 (1994)
Title Loeys-Dietz Syndrome .
Author Loeys,B.L. and Dietz,H.C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Thoracic Aortic Aneurysms and Aortic Dissections .
Author Milewicz,D.M. and Regalado,E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.