• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu14924 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu14924C Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001145256.1, 223671882
Length 1011 bp
Structure linear
Update Date 06-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA.
Product interleukin-1 receptor-associated kinase 4 isoform b
Comment

Summary: This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (3) lacks an alternate exon and uses a downstream start codon, compared to variant 1. The resulting isoform (b), also known as the short form, has a shorter N-terminus, compared to isoform a. Variants 3, 4, and 5 all encode the same isoform.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001138728.1
CDS 357..1367
Misc Feature(1)288..290
Misc Feature(2)549..1346
Misc Feature(3)549..1346
Misc Feature(4)561..1124
Misc Feature(5)order(561..572,582..584,615..617,621..623,720..722,
Misc Feature(6)order(561..572,582..584,615..617,621..623,720..722,
Misc Feature(7)order(570..572,789..791,795..797,915..917,921..923,
Misc Feature(8)order(966..986,1032..1043)
Exon (1)1..73
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (2)74..121
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (3)122..291
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (4)292..474
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (5)475..635
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (6)636..700
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (7)701..815
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (8)816..925
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (9)926..1109
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (10)1110..1172
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (11)1173..1331
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (12)1332..4195
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Translation MPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERP ISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHEN LVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHE NHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEI TPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADST SVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
94+dbSNP:
94+c, gdbSNP:4251432
143+dbSNP:
143+a, gdbSNP:56312115
151+a, gdbSNP:201400143
164+c, tdbSNP:377584435
165+a, gdbSNP:370524518
188+a, tdbSNP:143625818
207+c, tdbSNP:138116867
229+a, gdbSNP:115877973
245+a, gdbSNP:113588409
247+a, tdbSNP:141039652
302+dbSNP:
302+c, gdbSNP:56338336
330+a, gdbSNP:62642475
415+c, gdbSNP:147079926
429+c, gdbSNP:375927287
430+a, gdbSNP:112228761
463+a, tdbSNP:201782959
513+dbSNP:
513+a, gdbSNP:141209982
521+c, gdbSNP:373731553
531+c, tdbSNP:114951157
532+a, gdbSNP:186194251
545+c, tdbSNP:137949295
578+a, tdbSNP:113948349
582+c, gdbSNP:377074100
589+a, gdbSNP:191097365
597+a, gdbSNP:370225662
622+a, tdbSNP:149453390
654+dbSNP:
654+a, gdbSNP:201500711
675+a, gdbSNP:111935971
681+a, gdbSNP:200082169
704+dbSNP:
704+c, tdbSNP:144854858
726+c, tdbSNP:375755560
770+c, tdbSNP:201704200
771+a, gdbSNP:112517169
803+a, tdbSNP:370042548
809+c, tdbSNP:140210540
849+dbSNP:
849+c, tdbSNP:373167326
854+c, gdbSNP:145622820
861+c, tdbSNP:121908002
864+a, gdbSNP:200883675
883+a, gdbSNP:376948391
900+a, cdbSNP:115573494
908+a, tdbSNP:374532899
946+dbSNP:
946+a, tdbSNP:147301051
1021+a, gdbSNP:368108618
1041+a, gdbSNP:140869783
1047+a, cdbSNP:142376871
1093+c, tdbSNP:372448559
1147+dbSNP:
1147+a, tdbSNP:151272504
1153+a, gdbSNP:4251583
1155+c, tdbSNP:114820168
1156+a, gdbSNP:55944915
1213+dbSNP:
1213+c, tdbSNP:146538989
1266+a, gdbSNP:4251545
1298+c, tdbSNP:144842940
1322+c, tdbSNP:138719119
1350+dbSNP:
1350+a, gdbSNP:148873968
1351+a, tdbSNP:372068514
1386+c, tdbSNP:199727839
1419+a, tdbSNP:184380424
1513+c, tdbSNP:4251546
1517+a, gdbSNP:182322900
1612+a, gdbSNP:187201106
1637+c, tdbSNP:4251547
1648+a, gdbSNP:4251548
1672+g, tdbSNP:115845154
1709+g, tdbSNP:147004395
1795+a, tdbSNP:4251549
1829+c, tdbSNP:191617315
1855+a, tdbSNP:183559035
1887+a, tdbSNP:4251550
1975+a, gdbSNP:4251551
complement(1987)-g, adbSNP:138178820
1990+a, gdbSNP:4251552
2216..2217+, adbSNP:36085436
2356+g, tdbSNP:4251584
2475+a, gdbSNP:141847763
2639+g, tdbSNP:182497864
2640+c, tdbSNP:111571285
2656+a, cdbSNP:150604439
2692+a, gdbSNP:139778399
2706..2707+, ataadbSNP:138875923
2725..2728+, aaatdbSNP:368676868
2731+g, tdbSNP:186825265
2768+g, tdbSNP:4251553
2910+a, gdbSNP:139675032
3049+g, tdbSNP:192534409
3127+a, gdbSNP:144535012
3144+a, tdbSNP:4251554
3161+c, tdbSNP:4251555
3191..3193+, cttdbSNP:79794889
3254+c, tdbSNP:4251556
3255+a, gdbSNP:183931852
3260+c, tdbSNP:4251557
3262+a, gdbSNP:4251558
3341+a, gdbSNP:12321678
3407+a, gdbSNP:371821781
3450+c, gdbSNP:111813306
3490+g, tdbSNP:374721629
3555+a, gdbSNP:1141168
3633+a, gdbSNP:4251560
3712+a, gdbSNP:368152755
complement(3800)-g, adbSNP:9849
3911+a, gdbSNP:76405665
3929+c, gdbSNP:145856072
complement(3979)-t, cdbSNP:147831464
4033+g, tdbSNP:375914722
4036+c, tdbSNP:12310328
4071+c, tdbSNP:4251562
4119+c, tdbSNP:369823166
4128+a, gdbSNP:4251563
4184+a, gdbSNP:4251564
Gene SymbolIRAK4
Gene SynonymIPD1; IRAK-4; NY-REN-64; REN64
Chromosome12
Locus Map12q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. On-demand $219.00 7-9
Title A kinome-wide siRNA screen identifies multiple roles for protein kinases in hypoxic stress adaptation, including roles for IRAK4 and .
Author Pan J, Zhang J, Hill A, Lapan P, Berasi S, Bates B, Miller C and Haney S.
Journal J Biomol Screen 18 (7), 782-796 (2013)
Title Temozolomide-modulated glioma proteome: role of interleukin-1 receptor-associated kinase-4 (IRAK4) in chemosensitivity .
Author Kumar DM, Patil V, Ramachandran B, Nila MV, Dharmalingam K and Somasundaram K.
Journal Proteomics 13 (14), 2113-2124 (2013)
Title IRAK4 turns IL-10+ phospho-FOXO+ monocytes into pro-inflammatory cells by suppression of protein kinase B .
Author Over B, Ziegler S, Foermer S, Weber AN, Bode KA, Heeg K and Bekeredjian-Ding I.
Journal Eur. J. Immunol. 43 (6), 1630-1642 (2013)
Title Regulation of TLR2-mediated tolerance and cross-tolerance through IRAK4 modulation by miR-132 and miR-212 .
Author Nahid MA, Yao B, Dominguez-Gutierrez PR, Kesavalu L, Satoh M and Chan EK.
Journal J. Immunol. 190 (3), 1250-1263 (2013)
Title Crystal structures of IRAK-4 kinase in complex with inhibitors: a serine/threonine kinase with tyrosine as a gatekeeper .
Author Wang Z, Liu J, Sudom A, Ayres M, Li S, Wesche H, Powers JP and Walker NP.
Journal Structure 14 (12), 1835-1844 (2006)
Title IRAK-4--a shared NF-kappaB activator in innate and acquired immunity .
Author Suzuki N and Saito T.
Journal Trends Immunol. 27 (12), 566-572 (2006)
Title Severe impairment of interleukin-1 and Toll-like receptor signalling in mice lacking IRAK-4 .
Author Suzuki N, Suzuki S, Duncan GS, Millar DG, Wada T, Mirtsos C, Takada H, Wakeham A, Itie A, Li S, Penninger JM, Wesche H, Ohashi PS, Mak
Journal Nature 416 (6882), 750-756 (2002)
Title Tollip, a new component of the IL-1RI pathway, links IRAK to the IL-1 receptor .
Author Burns K, Clatworthy J, Martin L, Martinon F, Plumpton C, Maschera B, Lewis A, Ray K, Tschopp J and Volpe F.
Journal Nat. Cell Biol. 2 (6), 346-351 (2000)
Title Antigens recognized by autologous antibody in patients with renal-cell carcinoma .
Author Scanlan MJ, Gordan JD, Williamson B, Stockert E, Bander NH, Jongeneel V, Gure AO, Jager D, Jager E, Knuth A, Chen YT and Old LJ.
Journal Int. J. Cancer 83 (4), 456-464 (1999)
Title Analysis of a human V beta gene subfamily .
Author Siu,G., Strauss,E.C., Lai,E. and Hood,L.E.
Journal J. Exp. Med. 164 (5), 1600-1614 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.