• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA.


RefSeq Accession Definition Services Price Order
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. ORF Sequence $293.19
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001145256.1, 223671882
Length 4205 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA.
Product interleukin-1 receptor-associated kinase 4 isoform b
Comment

Summary: This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (3) lacks an alternate exon and uses a downstream start codon, compared to variant 1. The resulting isoform (b), also known as the short form, has a shorter N-terminus, compared to isoform a. Variants 3, 4, and 5 all encode the same isoform.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001138728.1
CDS 357..1367
Misc Feature(1)288..290
Misc Feature(2)549..1346
Misc Feature(3)549..1346
Misc Feature(4)561..1124
Misc Feature(5)order(561..572,582..584,615..617,621..623,720..722,
Misc Feature(6)order(561..572,582..584,615..617,621..623,720..722,
Misc Feature(7)order(570..572,789..791,795..797,915..917,921..923,
Misc Feature(8)order(966..986,1032..1043)
Exon (1)1..73
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (2)74..121
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (3)122..291
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (4)292..474
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (5)475..635
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (6)636..700
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (7)701..815
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (8)816..925
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (9)926..1109
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (10)1110..1172
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (11)1173..1331
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Exon (12)1332..4195
Gene:IRAK4
Gene Synonym:IPD1; IRAK-4; NY-REN-64; REN64
Translation MPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERP ISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHEN LVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHE NHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEI TPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADST SVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
4+dbSNP:
4+, c, gdbSNP:34440141
94+dbSNP:
94+c, gdbSNP:4251432
143+dbSNP:
143+a, gdbSNP:56312115
151+a, gdbSNP:201400143
188+a, tdbSNP:143625818
207+c, tdbSNP:138116867
229+a, gdbSNP:115877973
245+a, gdbSNP:113588409
247+a, tdbSNP:141039652
302+dbSNP:
302+c, gdbSNP:56338336
330+a, gdbSNP:62642475
415+c, gdbSNP:147079926
430+a, gdbSNP:112228761
463+a, tdbSNP:201782959
513+dbSNP:
513+a, gdbSNP:141209982
531+c, tdbSNP:114951157
532+a, gdbSNP:186194251
545+c, tdbSNP:137949295
573+, tdbSNP:67163243
578+a, tdbSNP:113948349
589+a, gdbSNP:191097365
622+a, tdbSNP:149453390
654+dbSNP:
654+a, gdbSNP:201500711
675+a, gdbSNP:111935971
681+a, gdbSNP:200082169
704+dbSNP:
704+c, tdbSNP:144854858
770+c, tdbSNP:201704200
771+a, gdbSNP:112517169
809+c, tdbSNP:140210540
854+dbSNP:
854+c, gdbSNP:145622820
861+c, tdbSNP:121908002
864+a, gdbSNP:200883675
900+a, cdbSNP:115573494
946+dbSNP:
946+a, tdbSNP:147301051
1041+a, gdbSNP:140869783
1047+a, cdbSNP:142376871
1147+dbSNP:
1147+a, tdbSNP:151272504
1153+a, gdbSNP:4251583
1155+c, tdbSNP:114820168
1156+a, gdbSNP:55944915
1213+dbSNP:
1213+c, tdbSNP:146538989
1266+a, gdbSNP:4251545
1298+c, tdbSNP:144842940
1322+c, tdbSNP:138719119
1350+dbSNP:
1350+a, gdbSNP:148873968
1386+c, tdbSNP:199727839
1419+a, tdbSNP:184380424
1513+c, tdbSNP:4251546
1517+a, gdbSNP:182322900
1612+a, gdbSNP:187201106
1637+c, tdbSNP:4251547
1648+a, gdbSNP:4251548
1672+g, tdbSNP:115845154
1709+g, tdbSNP:147004395
1795+a, tdbSNP:4251549
1829+c, tdbSNP:191617315
1855+a, tdbSNP:183559035
1887+a, tdbSNP:4251550
1975+a, gdbSNP:4251551
1987+a, gdbSNP:138178820
1990+a, gdbSNP:4251552
2216..2217+, adbSNP:36085436
2356+g, tdbSNP:4251584
2475+a, gdbSNP:141847763
2639+g, tdbSNP:182497864
2640+c, tdbSNP:111571285
2656+a, cdbSNP:150604439
2692+a, gdbSNP:139778399
2706..2707+, ataadbSNP:138875923
2731+g, tdbSNP:186825265
2768+g, tdbSNP:4251553
2910+a, gdbSNP:139675032
3049+g, tdbSNP:192534409
3127+a, gdbSNP:144535012
3144+a, tdbSNP:4251554
3161+c, tdbSNP:4251555
3191+, cttdbSNP:79794889
3254+c, tdbSNP:4251556
3255+a, gdbSNP:183931852
3260+c, tdbSNP:4251557
3262+a, gdbSNP:4251558
3341+a, gdbSNP:12321678
3450+c, gdbSNP:111813306
3555+a, gdbSNP:1141168
3633+a, gdbSNP:4251560
3800+a, gdbSNP:9849
3911+a, gdbSNP:76405665
3929+c, gdbSNP:145856072
3979+c, tdbSNP:147831464
4036+c, tdbSNP:12310328
4071+c, tdbSNP:4251562
4128+a, gdbSNP:4251563
4184+a, gdbSNP:4251564
Gene SymbolIRAK4
Gene SynonymIPD1; IRAK-4; NY-REN-64; REN64
Chromosome12
Locus Map12q12
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001114182 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 1, mRNA. Full Length $1522.85
ORF Sequence $401.07
NM_001145256 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 3, mRNA. Full Length $1471.75
ORF Sequence $293.19
NM_001145257 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 4, mRNA. Full Length $1454.95
ORF Sequence $293.19
NM_001145258 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 5, mRNA. Full Length $1395.45
ORF Sequence $293.19
NM_016123 Homo sapiens interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 2, mRNA. Full Length $1506.05
ORF Sequence $401.07
Title Regulation of TLR2-mediated tolerance and cross-tolerance through IRAK4 modulation by miR-132 and miR-212 .
Author Nahid,M.A., Yao,B., Dominguez-Gutierrez,P.R., Kesavalu,L., Satoh,M. and Chan,E.K.
Journal J. Immunol. 190 (3), 1250-1263 (2013)
Title Augmentation of therapeutic responses in melanoma by inhibition of IRAK-1,-4 .
Author Srivastava,R., Geng,D., Liu,Y., Zheng,L., Li,Z., Joseph,M.A., McKenna,C., Bansal,N., Ochoa,A. and Davila,E.
Journal Cancer Res. 72 (23), 6209-6216 (2012)
Title Experimental and natural infections in MyD88- and IRAK-4-deficient mice and humans .
Author von Bernuth,H., Picard,C., Puel,A. and Casanova,J.L.
Journal Eur. J. Immunol. 42 (12), 3126-3135 (2012)
Title Loss of interleukin receptor-associated kinase 4 signaling suppresses amyloid pathology and alters microglial phenotype in a mouse model of Alzheimer's disease .
Author Cameron,B., Tse,W., Lamb,R., Li,X., Lamb,B.T. and Landreth,G.E.
Journal J. Neurosci. 32 (43), 15112-15123 (2012)
Title Crystal structures of IRAK-4 kinase in complex with inhibitors: a serine/threonine kinase with tyrosine as a gatekeeper .
Author Wang,Z., Liu,J., Sudom,A., Ayres,M., Li,S., Wesche,H., Powers,J.P. and Walker,N.P.
Journal Structure 14 (12), 1835-1844 (2006)
Title IRAK-4--a shared NF-kappaB activator in innate and acquired immunity .
Author Suzuki,N. and Saito,T.
Journal Trends Immunol. 27 (12), 566-572 (2006)
Title Severe impairment of interleukin-1 and Toll-like receptor signalling in mice lacking IRAK-4 .
Author Suzuki,N., Suzuki,S., Duncan,G.S., Millar,D.G., Wada,T., Mirtsos,C., Takada,H., Wakeham,A., Itie,A., Li,S., Penninger,J.M., Wesche,H., Ohashi,P.S., Mak,T.W. and Yeh,W.C.
Journal Nature 416 (6882), 750-756 (2002)
Title Tollip, a new component of the IL-1RI pathway, links IRAK to the IL-1 receptor .
Author Burns,K., Clatworthy,J., Martin,L., Martinon,F., Plumpton,C., Maschera,B., Lewis,A., Ray,K., Tschopp,J. and Volpe,F.
Journal Nat. Cell Biol. 2 (6), 346-351 (2000)
Title Antigens recognized by autologous antibody in patients with renal-cell carcinoma .
Author Scanlan,M.J., Gordan,J.D., Williamson,B., Stockert,E., Bander,N.H., Jongeneel,V., Gure,A.O., Jager,D., Jager,E., Knuth,A., Chen,Y.T. and Old,L.J.
Journal Int. J. Cancer 83 (4), 456-464 (1999)
Title Analysis of a human V beta gene subfamily .
Author Siu,G., Strauss,E.C., Lai,E. and Hood,L.E.
Journal J. Exp. Med. 164 (5), 1600-1614 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878