• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001145443 Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_001145443.1, 224282148
Length 4224 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA.
Product 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase 3 isoform 2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DC323583.1, D49817.1 and AL359960.23.


Transcript Variant: This variant (2) has an alternate 5' exon, as compared to variant 1. The resulting isoform (2) has a shorter and different N-terminus, as compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001138915.1
CDS 119..1621
Misc Feature(1)137..796
Misc Feature(2)137..796
Misc Feature(3)order(182..184,197..208)
Misc Feature(4)800..1360
Misc Feature(5)order(815..820,965..967,1220..1225)
Exon (1)1..134
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (2)135..260
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (3)261..357
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (4)358..424
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (5)425..499
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (6)500..556
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (7)557..681
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (8)682..889
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (9)890..1036
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (10)1037..1141
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (11)1142..1271
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (12)1272..1334
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (13)1335..1399
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (14)1400..1573
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (15)1574..4224
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Translation MPFRKACGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVK QYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHF AKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQP LDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHN LQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKA LNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQ ENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVC THRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPT QLPGQNMKGSRSSADSSRKH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
167+dbSNP:
167+a, gdbSNP:200349885
173+a, gdbSNP:142603218
190+c, tdbSNP:146319524
226+g, tdbSNP:138221143
269+dbSNP:
269+a, gdbSNP:181651478
331+c, tdbSNP:199980015
338+a, gdbSNP:149555675
353+c, tdbSNP:201889586
354+c, tdbSNP:36005730
496+dbSNP:
496+c, tdbSNP:138054261
501+dbSNP:
501+c, tdbSNP:144243977
502+c, tdbSNP:34969226
517+a, gdbSNP:79668213
562+dbSNP:
562+a, tdbSNP:201048797
637+c, tdbSNP:147548407
667+c, tdbSNP:140074833
668+a, gdbSNP:199606482
691+dbSNP:
691+a, g, tdbSNP:145567510
709+c, tdbSNP:150949806
717+a, gdbSNP:140784797
763+c, tdbSNP:2230271
829+c, tdbSNP:145448801
848+c, tdbSNP:140258391
854+c, tdbSNP:34832528
866+a, gdbSNP:12569742
878+c, tdbSNP:200723320
879+a, gdbSNP:200580141
896+dbSNP:
896+a, gdbSNP:145547756
938+a, gdbSNP:34714325
988+a, gdbSNP:138134300
992+c, tdbSNP:140957456
1003+c, tdbSNP:34184265
1031+a, gdbSNP:199705255
1035+c, tdbSNP:35117690
1039+dbSNP:
1039+a, cdbSNP:148105023
1095+c, tdbSNP:141885543
1156+dbSNP:
1156+c, gdbSNP:150649154
1207+a, gdbSNP:2230272
1228+c, tdbSNP:139855095
1260+a, tdbSNP:202182009
1265+a, gdbSNP:201735991
1306+dbSNP:
1306+c, tdbSNP:199594802
1307+a, gdbSNP:143044080
1310+c, tdbSNP:202060851
1351+dbSNP:
1351+a, gdbSNP:35050271
1363+a, cdbSNP:140195872
1373+a, gdbSNP:145516111
1385+c, tdbSNP:144329353
1390+c, gdbSNP:148777860
1422+dbSNP:
1422+c, tdbSNP:143645269
1445+a, gdbSNP:151179469
1450+c, tdbSNP:35877496
1518+c, tdbSNP:143989781
1519+a, gdbSNP:146509899
1522+c, tdbSNP:141132608
1541+a, cdbSNP:61731874
1546+a, gdbSNP:200977986
1557+a, cdbSNP:150176706
1558+a, gdbSNP:201949985
1576+dbSNP:
1576+c, tdbSNP:145555537
1584+g, tdbSNP:35413228
1606+c, tdbSNP:61731875
1629+a, gdbSNP:188624660
1634+a, gdbSNP:193259523
1665+a, gdbSNP:201758210
1683+a, gdbSNP:3750665
1717+a, gdbSNP:114458714
1771+g, tdbSNP:11257460
1827+g, tdbSNP:111841872
1851+c, tdbSNP:41291285
1861+c, tdbSNP:1539232
1896+c, g, tdbSNP:56656269
1924+a, gdbSNP:188911010
1939+a, gdbSNP:1539233
2087..2088+, cdbSNP:34059583
2162+c, gdbSNP:41291287
2184+c, gdbSNP:149180628
2214+a, gdbSNP:11541590
2249+a, tdbSNP:115020525
2318+c, tdbSNP:3750667
2389+c, gdbSNP:75380779
2465+a, cdbSNP:138719592
2488+a, gdbSNP:36102318
2492+c, tdbSNP:55643411
2500+c, gdbSNP:3829148
2538+c, tdbSNP:181624552
2575+c, gdbSNP:1064887
2620+c, tdbSNP:116150030
2623+a, tdbSNP:1064888
2751+a, gdbSNP:35781052
2762+a, gdbSNP:146927431
2825+c, tdbSNP:137871718
2841+c, tdbSNP:183868086
2842+g, tdbSNP:188597321
3098+a, gdbSNP:1064889
3205+c, gdbSNP:1064890
3226+c, tdbSNP:11541589
3273+a, gdbSNP:180716582
3275+a, gdbSNP:113076566
3278+c, gdbSNP:150577187
3282..3283+, tcdbSNP:201934407
3290+c, tdbSNP:1064891
3325+a, gdbSNP:1064892
3348+a, tdbSNP:111928593
3354+a, gdbSNP:149295239
3410+a, tdbSNP:1064893
3435+c, tdbSNP:186096730
3436+c, tdbSNP:3814190
3439+c, gdbSNP:1064894
3456+a, cdbSNP:1064895
3459+a, gdbSNP:1539234
3467+a, tdbSNP:1064896
3481+a, gdbSNP:1064897
3553+c, tdbSNP:190957966
3651+a, cdbSNP:1064898
3700+a, cdbSNP:113438580
3715+c, gdbSNP:1064899
3728+a, cdbSNP:1064900
3830..3831+, ccdbSNP:57936464
3837+c, tdbSNP:146257115
3878+g, tdbSNP:182354027
3969+g, tdbSNP:186547454
4070..4071+, adbSNP:147522216
4107+a, cdbSNP:74795188
4198+c, gdbSNP:76767288
Gene SymbolPFKFB3
Gene SynonymIPFK2; PFK2
Chromosome10
Locus Map10p15.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001145443 Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA. On-demand $699.00 18
NM_004566 Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 1, mRNA. In-stock $509.00 $460.00 12
Title Molecular basis of the fructose-2,6-bisphosphatase reaction of PFKFB3: transition state and the C-terminal function .
Author Cavalier,M.C., Kim,S.G., Neau,D. and Lee,Y.H.
Journal Proteins 80 (4), 1143-1153 (2012)
Title The JAK2V617F oncogene requires expression of inducible phosphofructokinase/fructose-bisphosphatase 3 for cell growth and increased metabolic activity .
Author Reddy,M.M., Fernandes,M.S., Deshpande,A., Weisberg,E., Inguilizian,H.V., Abdel-Wahab,O., Kung,A.L., Levine,R.L., Griffin,J.D. and Sattler,M.
Journal Leukemia 26 (3), 481-489 (2012)
Title Molecular basis for the differential use of glucose and glutamine in cell proliferation as revealed by synchronized HeLa cells .
Author Colombo,S.L., Palacios-Callender,M., Frakich,N., Carcamo,S., Kovacs,I., Tudzarova,S. and Moncada,S.
Journal Proc. Natl. Acad. Sci. U.S.A. 108 (52), 21069-21074 (2011)
Title LOH on 10p14-p15 targets the PFKFB3 gene locus in human glioblastomas .
Author Fleischer,M., Kessler,R., Klammer,A., Warnke,J.P. and Eschrich,K.
Journal Genes Chromosomes Cancer 50 (12), 1010-1020 (2011)
Title Two ubiquitin ligases, APC/C-Cdh1 and SKP1-CUL1-F (SCF)-beta-TrCP, sequentially regulate glycolysis during the cell cycle .
Author Tudzarova,S., Colombo,S.L., Stoeber,K., Carcamo,S., Williams,G.H. and Moncada,S.
Journal Proc. Natl. Acad. Sci. U.S.A. 108 (13), 5278-5283 (2011)
Title Characterization of a human placental fructose-6-phosphate, 2-kinase/fructose-2,6-bisphosphatase .
Author Sakakibara,R., Kato,M., Okamura,N., Nakagawa,T., Komada,Y., Tominaga,N., Shimojo,M. and Fukasawa,M.
Journal J. Biochem. 122 (1), 122-128 (1997)
Title The third human isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3) map position 10p14-p15 .
Author Nicholl,J., Hamilton,J.A., Sutherland,G.R., Sutherland,R.L. and Watts,C.K.
Journal Chromosome Res. 5 (2), 150 (1997)
Title Identification of PRG1, a novel progestin-responsive gene with sequence homology to 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase .
Author Hamilton,J.A., Callaghan,M.J., Sutherland,R.L. and Watts,C.K.
Journal Mol. Endocrinol. 11 (4), 490-502 (1997)
Title Cloning of cDNA encoding for a novel isozyme of fructose 6-phosphate, 2-kinase/fructose 2,6-bisphosphatase from human placenta .
Author Sakai,A., Kato,M., Fukasawa,M., Ishiguro,M., Furuya,E. and Sakakibara,R.
Journal J. Biochem. 119 (3), 506-511 (1996)
Title 6-Phosphofructo-2-kinase/fructose-2,6-bisphosphatase: a metabolic signaling enzyme .
Author Pilkis,S.J., Claus,T.H., Kurland,I.J. and Lange,A.J.
Journal Annu. Rev. Biochem. 64, 799-835 (1995)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.