• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu14704 Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu14704C Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001145443.1, 224282148
Length 1503 bp
Structure linear
Update Date 05-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA.
Product 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase 3 isoform 2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DC323583.1, D49817.1 and AL359960.23.


Transcript Variant: This variant (2) uses an alternate 5' terminal exon compared to variant 1. The resulting isoform (2) has a shorter and distinct N-terminus compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001138915.1
CDS 119..1621
Misc Feature(1)128..796
Misc Feature(2)128..796
Misc Feature(3)800..1360
Misc Feature(4)order(815..820,965..967,1220..1225)
Exon (1)1..134
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (2)135..260
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (3)261..357
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (4)358..424
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (5)425..499
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (6)500..556
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (7)557..681
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (8)682..889
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (9)890..1036
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (10)1037..1141
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (11)1142..1271
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (12)1272..1334
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (13)1335..1399
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (14)1400..1573
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Exon (15)1574..4224
Gene:PFKFB3
Gene Synonym:IPFK2; PFK2
Translation MPFRKACGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVK QYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHF AKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQP LDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHN LQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKA LNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQ ENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVC THRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPT QLPGQNMKGSRSSADSSRKH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
38+dbSNP:
38+c, tdbSNP:373281337
166+dbSNP:
166+c, tdbSNP:371698685
167+a, gdbSNP:200349885
173+a, gdbSNP:142603218
190+c, tdbSNP:146319524
226+g, tdbSNP:138221143
248+a, gdbSNP:375018306
269+dbSNP:
269+a, gdbSNP:181651478
271+c, tdbSNP:374201933
305+a, gdbSNP:376208847
331+c, tdbSNP:199980015
338+a, gdbSNP:149555675
353+c, tdbSNP:201889586
354+c, tdbSNP:36005730
496+dbSNP:
496+c, tdbSNP:138054261
501+dbSNP:
501+c, tdbSNP:144243977
502+c, tdbSNP:34969226
517+a, gdbSNP:79668213
544+c, gdbSNP:374769986
562+dbSNP:
562+a, g, tdbSNP:201048797
566+a, gdbSNP:373530404
598+a, gdbSNP:377330736
637+c, tdbSNP:147548407
667+c, tdbSNP:140074833
668+a, gdbSNP:199606482
691+dbSNP:
691+a, g, tdbSNP:145567510
705+c, tdbSNP:369033520
709+c, tdbSNP:150949806
710+a, gdbSNP:373816623
717+a, gdbSNP:140784797
763+c, tdbSNP:2230271
787+c, tdbSNP:376533039
788+a, gdbSNP:369124719
795+c, tdbSNP:373844823
829+c, tdbSNP:145448801
848+c, tdbSNP:140258391
849+g, tdbSNP:377041246
853+a, cdbSNP:370128069
complement(854)-t, cdbSNP:34832528
866+a, gdbSNP:12569742
878+c, tdbSNP:200723320
879+a, gdbSNP:200580141
896+dbSNP:
896+a, gdbSNP:145547756
complement(938)-g, adbSNP:34714325
941+c, tdbSNP:372640050
943+c, tdbSNP:372042331
988+a, gdbSNP:138134300
992+c, tdbSNP:140957456
1003+c, tdbSNP:34184265
1018+a, gdbSNP:376217797
1031+a, gdbSNP:199705255
1035+c, tdbSNP:35117690
1039+dbSNP:
1039+a, cdbSNP:148105023
1040+a, gdbSNP:371075114
1060+c, tdbSNP:376330766
1091+a, tdbSNP:368231126
1095+c, tdbSNP:141885543
1096+a, gdbSNP:372499415
1126+c, gdbSNP:369242634
1156+dbSNP:
1156+c, gdbSNP:150649154
1180+c, tdbSNP:369277668
1207+a, gdbSNP:2230272
1228+c, tdbSNP:139855095
1260+a, tdbSNP:202182009
1265+a, gdbSNP:201735991
1288+dbSNP:
1288+a, gdbSNP:370388643
1306+c, tdbSNP:199594802
1307+a, gdbSNP:143044080
1310+c, tdbSNP:202060851
1345+dbSNP:
1345+a, gdbSNP:368503704
complement(1351)-g, adbSNP:35050271
1363+a, cdbSNP:140195872
1373+a, gdbSNP:145516111
1385+c, tdbSNP:144329353
1390+c, gdbSNP:148777860
1422+dbSNP:
1422+c, tdbSNP:143645269
1435+c, gdbSNP:374784976
complement(1450)-t, cdbSNP:35877496
1463+a, gdbSNP:368490604
1499+a, gdbSNP:372262915
1503+a, cdbSNP:375524545
1507+g, tdbSNP:371283024
1518+c, tdbSNP:143989781
1519+a, gdbSNP:146509899
1522+c, tdbSNP:141132608
1528+a, gdbSNP:372800366
1541+a, cdbSNP:61731874
1546+a, gdbSNP:200977986
1555+c, tdbSNP:376238290
1557+a, cdbSNP:150176706
1558+a, gdbSNP:201949985
1576+dbSNP:
1576+c, tdbSNP:145555537
1584+g, tdbSNP:35413228
1590+a, gdbSNP:368989673
1606+c, tdbSNP:61731875
1628+c, tdbSNP:373386969
1629+a, gdbSNP:188624660
1633+c, tdbSNP:374134958
1634+a, gdbSNP:193259523
1665+a, gdbSNP:201758210
1683+a, gdbSNP:3750665
1717+a, gdbSNP:114458714
1771+g, tdbSNP:11257460
1789+c, tdbSNP:370060304
1826+c, tdbSNP:373062080
1827+g, tdbSNP:111841872
1851+c, tdbSNP:41291285
1861+c, tdbSNP:1539232
1896+c, g, tdbSNP:56656269
1924+a, gdbSNP:188911010
1939+a, gdbSNP:1539233
2088..2089+, cdbSNP:34059583
2162+c, gdbSNP:41291287
2162+c, gdbSNP:386443295
2184+c, gdbSNP:149180628
2214+a, gdbSNP:11541590
2249+a, tdbSNP:115020525
2318+c, tdbSNP:3750667
complement(2389)-g, cdbSNP:75380779
2412+g, tdbSNP:371109958
2465+a, cdbSNP:138719592
2488+a, gdbSNP:36102318
2492+c, tdbSNP:55643411
2500+c, gdbSNP:3829148
2538+c, tdbSNP:181624552
2575+c, gdbSNP:1064887
2620+c, tdbSNP:116150030
2623+a, tdbSNP:1064888
complement(2751)-g, adbSNP:35781052
2762+a, gdbSNP:146927431
2825+c, tdbSNP:137871718
2841+c, tdbSNP:183868086
2842+g, tdbSNP:188597321
3098+a, gdbSNP:1064889
3205+c, gdbSNP:1064890
3210+c, tdbSNP:373060819
3226+c, tdbSNP:11541589
3273+a, gdbSNP:180716582
3275+a, gdbSNP:113076566
3278+c, gdbSNP:150577187
3282..3283+, tcdbSNP:201934407
3290+c, tdbSNP:1064891
3325+a, gdbSNP:1064892
3348+a, tdbSNP:111928593
3354+a, gdbSNP:149295239
3410+a, tdbSNP:1064893
3435+c, tdbSNP:186096730
complement(3436)-t, cdbSNP:3814190
3439+c, gdbSNP:1064894
3456+a, cdbSNP:1064895
3459+a, gdbSNP:1539234
3467+a, tdbSNP:1064896
3481+a, gdbSNP:1064897
3553+c, tdbSNP:190957966
3577+a, gdbSNP:373840460
3651+a, cdbSNP:1064898
3700+a, cdbSNP:113438580
3715+c, gdbSNP:1064899
3728+a, cdbSNP:1064900
3835..3836+, ccdbSNP:57936464
complement(3837)-t, cdbSNP:146257115
3878+g, tdbSNP:182354027
3969+g, tdbSNP:186547454
4070..4071+, adbSNP:147522216
4072+c, tdbSNP:372346664
4096+g, tdbSNP:371173465
4107+a, cdbSNP:74795188
4198+c, gdbSNP:76767288
Gene SymbolPFKFB3
Gene SynonymIPFK2; PFK2
Chromosome10
Locus Map10p15.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001145443 Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_001145443 Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_001145443 Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_001145443 Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_001145443 Homo sapiens 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), transcript variant 2, mRNA. On-demand $219.00 7-9
Title Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells .
Author Yang Z, Fujii H, Mohan SV, Goronzy JJ and Weyand CM.
Journal J. Exp. Med. 210 (10), 2119-2134 (2013)
Title Role of PFKFB3-driven glycolysis in vessel sprouting .
Author De Bock K, Georgiadou M, Schoors S, Kuchnio A, Wong BW, Cantelmo AR, Quaegebeur A, Ghesquiere B, Cauwenberghs S, Eelen G, Phng LK, Betz I, Tembuyser B, Brepoels K, Welti J, Geudens I, Segura I, Cruys B, Bifari F, Decimo I, Blanco R, Wyns S, Vangindertael J, Rocha S, Collins RT, Munck S, Daelemans D, Imamura H, Devlieger R, Rider M, Van Veldhoven PP, Schuit F, Bartrons R, Hofkens J, Fraisl P, Telang S, Deberardinis RJ, Schoonjans L, Vinckier S, Chesney J, Gerhardt H, Dewerchin M and Carmeliet P.
Journal Cell 154 (3), 651-663 (2013)
Title PFKFB3 activation in cancer cells by the p38/MK2 pathway in response to stress stimuli .
Author Novellasdemunt L, Bultot L, Manzano A, Ventura F, Rosa JL, Vertommen D, Rider MH, Navarro-Sabate A and Bartrons R.
Journal Biochem. J. 452 (3), 531-543 (2013)
Title Molecular basis of the fructose-2,6-bisphosphatase reaction of PFKFB3: transition state and the C-terminal function .
Author Cavalier MC, Kim SG, Neau D and Lee YH.
Journal Proteins 80 (4), 1143-1153 (2012)
Title Molecular basis for the differential use of glucose and glutamine in cell proliferation as revealed by synchronized HeLa cells .
Author Colombo SL, Palacios-Callender M, Frakich N, Carcamo S, Kovacs I, Tudzarova S and Moncada S.
Journal Proc. Natl. Acad. Sci. U.S.A. 108 (52), 21069-21074 (2011)
Title Characterization of a human placental fructose-6-phosphate, 2-kinase/fructose-2,6-bisphosphatase .
Author Sakakibara R, Kato M, Okamura N, Nakagawa T, Komada Y, Tominaga N, Shimojo M and Fukasawa M.
Journal J. Biochem. 122 (1), 122-128 (1997)
Title The third human isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3) map position 10p14-p15 .
Author Nicholl J, Hamilton JA, Sutherland GR, Sutherland RL and Watts CK.
Journal Chromosome Res. 5 (2), 150 (1997)
Title Identification of PRG1, a novel progestin-responsive gene with sequence homology to 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase .
Author Hamilton JA, Callaghan MJ, Sutherland RL and Watts CK.
Journal Mol. Endocrinol. 11 (4), 490-502 (1997)
Title Cloning of cDNA encoding for a novel isozyme of fructose 6-phosphate, 2-kinase/fructose 2,6-bisphosphatase from human placenta .
Author Sakai A, Kato M, Fukasawa M, Ishiguro M, Furuya E and Sakakibara R.
Journal J. Biochem. 119 (3), 506-511 (1996)
Title 6-Phosphofructo-2-kinase/fructose-2,6-bisphosphatase: a metabolic signaling enzyme .
Author Pilkis SJ, Claus TH, Kurland IJ and Lange AJ.
Journal Annu. Rev. Biochem. 64, 799-835 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.