• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 5, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001145770 Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 5, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_001145770.1, 224809313
Length 3821 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 5, mRNA.
Product G-protein coupled receptor 56 isoform b precursor
Comment

Summary: This gene encodes a member of the G protein-coupled receptor family. The protein contains 7 transmembrane domains and a mucin-like domain in the N-terminal region. The gene is implicated in the regulation of brain cortical patterning. The protein binds specifically to transglutaminase 2 in the extracellular space. Expression of this gene is downregulated in melanoma cell lines, and overexpression of this gene can suppress tumor growth and metastasis. Mutations in this gene result in bilateral frontoparietal polymicrogyria. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009].


Transcript Variant: This variant (5) represents use of an alternate promoter, differs in the 5' UTR, and uses an alternate splice acceptor site in the central coding region, compared to variant 4. The resulting isoform (b) lacks an internal 6 aa segment, compared to isoform a. Variants 2, 3, 5, 6, and 7 encode the same isoform.

RefSeq NP_001139242.1
CDS 293..2356
Misc Feature(1)275..277
Misc Feature(2)275..277
Misc Feature(3)1319..1459
Misc Feature(4)1436..1441
Misc Feature(5)1499..2236
Misc Feature(6)1499..1561
Misc Feature(7)1619..1681
Misc Feature(8)1703..1765
Misc Feature(9)1829..1891
Misc Feature(10)2003..2065
Misc Feature(11)2102..2164
Misc Feature(12)2183..2245
Exon (1)1..139
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (2)140..257
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (3)258..356
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (4)357..779
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (5)780..912
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (6)913..1060
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (7)1061..1192
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (8)1193..1309
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (9)1310..1355
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (10)1356..1459
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (11)1460..1578
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (12)1579..1847
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (13)1848..1956
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (14)1957..2225
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Exon (15)2226..3806
Gene:GPR56
Gene Synonym:BFPP; TM7LN4; TM7XN1
Translation MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIEN SEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLL CFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELK RDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKL QPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQ DKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGH WSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLV TIAAYLCSRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSL LTCLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPII LAVHRTPEGVIYPSMCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKW SHVLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQAR GGPSPLKSNSDSARLPISSGSTSSSRI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
207+dbSNP:
207+c, tdbSNP:151010444
281+c, tdbSNP:202128979
282+a, gdbSNP:112775979
306+c, tdbSNP:147879224
318+c, tdbSNP:200241873
319+a, gdbSNP:142223451
336+a, gdbSNP:144515150
379+dbSNP:
379+a, gdbSNP:145668224
404+c, tdbSNP:121908462
424+c, tdbSNP:12599906
454+a, gdbSNP:143561619
466+c, tdbSNP:140963173
475+c, tdbSNP:200846541
483+c, tdbSNP:199870082
495+a, c, gdbSNP:140781731
506+c, tdbSNP:144561715
528+a, gdbSNP:13338340
535+c, tdbSNP:58068378
555+a, gdbSNP:121908466
564+c, gdbSNP:121908465
578+c, tdbSNP:146278035
614+c, tdbSNP:145881545
687..688+, cdbSNP:34819874
693+c, tdbSNP:138344683
694+a, gdbSNP:149607882
737+a, gdbSNP:144347830
755+g, tdbSNP:199910467
767+c, tdbSNP:199902692
796+dbSNP:
796+c, tdbSNP:113005540
845+c, tdbSNP:138495764
895+a, gdbSNP:143113602
904+c, tdbSNP:147495708
905+c, gdbSNP:201006096
913+dbSNP:
913+a, gdbSNP:202000184
915+a, cdbSNP:139864711
933+c, g, tdbSNP:114515505
976+c, tdbSNP:151214362
995+a, gdbSNP:139207635
1003+a, gdbSNP:148219127
1053+a, gdbSNP:145001300
1093+dbSNP:
1093+c, gdbSNP:141056936
1135+c, g, tdbSNP:1801257
1136+c, gdbSNP:146704802
1171..1172+, ttadbSNP:201811467
1210+dbSNP:
1210+a, cdbSNP:1801255
1269+c, tdbSNP:201754491
1277+a, gdbSNP:61744444
1288+c, tdbSNP:1376041
1302+c, tdbSNP:76355889
1328+dbSNP:
1328+a, tdbSNP:121908463
1365+dbSNP:
1365+c, tdbSNP:142015112
1371+a, gdbSNP:150233291
1396+c, tdbSNP:200032236
1416+c, tdbSNP:138890826
1485+dbSNP:
1485+c, tdbSNP:143257214
1562+a, gdbSNP:147479620
1591+dbSNP:
1591+a, gdbSNP:143798178
1606+a, gdbSNP:144238941
1615+g, tdbSNP:181901909
1630+c, tdbSNP:7198790
1631+a, gdbSNP:202092636
1644+a, gdbSNP:142684762
1648+a, gdbSNP:151020094
1663+c, tdbSNP:139909047
1664+a, gdbSNP:186550684
1707+c, gdbSNP:201132218
1728+c, gdbSNP:143407077
1752+c, tdbSNP:17379472
1754+a, gdbSNP:200680234
1854+dbSNP:
1854+c, tdbSNP:16958679
1860+g, tdbSNP:201202303
1939+c, tdbSNP:2278808
1967+dbSNP:
1967+c, tdbSNP:121908464
2067+a, g, tdbSNP:140298537
2097+a, gdbSNP:149868261
2102+c, tdbSNP:113358058
2108+c, gdbSNP:201661515
2213+a, gdbSNP:149045247
2257+a, gdbSNP:139927249
2258+c, tdbSNP:200285648
2268+c, gdbSNP:201080070
2271+a, gdbSNP:143389426
2275+c, tdbSNP:111939130
2283+c, tdbSNP:141728283
2308+c, tdbSNP:145354323
2329+a, gdbSNP:186736979
2375+a, cdbSNP:74022020
2394+g, tdbSNP:10852554
2402+a, gdbSNP:201611287
2430+a, cdbSNP:10852555
2454+c, tdbSNP:74022021
2464+a, gdbSNP:113439449
2510+a, gdbSNP:113137755
2544+a, gdbSNP:191543742
2545+g, tdbSNP:184796447
2547+c, gdbSNP:4784002
2552+c, tdbSNP:11556144
2554+g, tdbSNP:11556145
2606+c, g, tdbSNP:113562508
2657+c, tdbSNP:1823479
2660+a, cdbSNP:35572780
2905+c, tdbSNP:74573309
3120+a, gdbSNP:190451895
3147+c, tdbSNP:57937322
3188+c, tdbSNP:74520836
3197+g, tdbSNP:3211127
3266+c, tdbSNP:7191189
3274+c, tdbSNP:139681411
3284+a, gdbSNP:76377903
3363+a, g, tdbSNP:1043540
3414+c, tdbSNP:149861292
3425+a, gdbSNP:114876561
3458+c, tdbSNP:181632122
3461+a, gdbSNP:145861349
3484..3485+a, cdbSNP:12641
3576+a, cdbSNP:80206511
3595+c, tdbSNP:17240904
3659+a, cdbSNP:15437
3692+c, tdbSNP:139730624
3721+a, gdbSNP:115230856
3793+a, gdbSNP:3180467
Gene SymbolGPR56
Gene SynonymBFPP; TM7LN4; TM7XN1
Chromosome16
Locus Map16q13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001145770 Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 5, mRNA. On-demand $849.00 20
NM_001145771 Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 4, mRNA. On-demand $849.00 20
NM_001145772 Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 6, mRNA. On-demand $849.00 20
NM_001145773 Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 8, mRNA. On-demand $849.00 20
NM_001145774 Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 7, mRNA. On-demand $849.00 20
NM_005682 Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 1, mRNA. On-demand $849.00 20
NM_201524 Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 2, mRNA. On-demand $849.00 20
NM_201525 Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 3, mRNA. On-demand $849.00 20
Title Disease-associated mutations prevent GPR56-collagen III interaction .
Author Luo,R., Jin,Z., Deng,Y., Strokes,N. and Piao,X.
Journal PLoS ONE 7 (1), E29818 (2012)
Title Specific expression of GPR56 by human cytotoxic lymphocytes .
Author Peng,Y.M., van de Garde,M.D., Cheng,K.F., Baars,P.A., Remmerswaal,E.B., van Lier,R.A., Mackay,C.R., Lin,H.H. and Hamann,J.
Journal J. Leukoc. Biol. 90 (4), 735-740 (2011)
Title The N terminus of the adhesion G protein-coupled receptor GPR56 controls receptor signaling activity .
Author Paavola,K.J., Stephenson,J.R., Ritter,S.L., Alter,S.P. and Hall,R.A.
Journal J. Biol. Chem. 286 (33), 28914-28921 (2011)
Title GPR56 Regulates VEGF production and angiogenesis during melanoma progression .
Author Yang,L., Chen,G., Mohanty,S., Scott,G., Fazal,F., Rahman,A., Begum,S., Hynes,R.O. and Xu,L.
Journal Cancer Res. 71 (16), 5558-5568 (2011)
Title A novel GPR56 mutation causes bilateral frontoparietal polymicrogyria .
Author Luo,R., Yang,H.M., Jin,Z., Halley,D.J., Chang,B.S., MacPherson,L., Brueton,L. and Piao,X.
Journal Pediatr. Neurol. 45 (1), 49-53 (2011)
Title G protein-coupled receptor-dependent development of human frontal cortex .
Author Piao,X., Hill,R.S., Bodell,A., Chang,B.S., Basel-Vanagaite,L., Straussberg,R., Dobyns,W.B., Qasrawi,B., Winter,R.M., Innes,A.M., Voit,T., Ross,M.E., Michaud,J.L., Descarie,J.C., Barkovich,A.J. and Walsh,C.A.
Journal Science 303 (5666), 2033-2036 (2004)
Title The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment .
Author Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J., Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B., Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E., Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S., Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C., Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V., Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K., Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z., Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
Journal Genome Res. 13 (10), 2265-2270 (2003)
Title An autosomal recessive form of bilateral frontoparietal polymicrogyria maps to chromosome 16q12.2-21 .
Author Piao,X., Basel-Vanagaite,L., Straussberg,R., Grant,P.E., Pugh,E.W., Doheny,K., Doan,B., Hong,S.E., Shugart,Y.Y. and Walsh,C.A.
Journal Am. J. Hum. Genet. 70 (4), 1028-1033 (2002)
Title TM7XN1, a novel human EGF-TM7-like cDNA, detected with mRNA differential display using human melanoma cell lines with different metastatic potential .
Author Zendman,A.J., Cornelissen,I.M., Weidle,U.H., Ruiter,D.J. and van Muijen,G.N.
Journal FEBS Lett. 446 (2-3), 292-298 (1999)
Title GPR56, a novel secretin-like human G-protein-coupled receptor gene .
Author Liu,M., Parker,R.M., Darby,K., Eyre,H.J., Copeland,N.G., Crawford,J., Gilbert,D.J., Sutherland,G.R., Jenkins,N.A. and Herzog,H.
Journal Genomics 55 (3), 296-305 (1999)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.