• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 5, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu17740 Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 5, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu17740C Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 5, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001145770.2, 589269189
Length 2064 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens G protein-coupled receptor 56 (GPR56), transcript variant 5, mRNA.
Product G-protein coupled receptor 56 isoform b precursor
Comment

Summary: This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014].


Transcript Variant: This variant (5) represents use of an alternate promoter, differs in the 5' UTR, and uses an alternate in-frame splice site in the coding region compared to variant 4. The resulting isoform (b, also known as S1) is shorter than isoform a. Variants 2, 3, 5, 6, and 7 encode the same isoform.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001139242.1
CDS 293..2356
Misc Feature(1)275..277
Misc Feature(2)275..277
Misc Feature(3)1319..1459
Misc Feature(4)1436..1441
Misc Feature(5)1499..2236
Misc Feature(6)1499..1561
Misc Feature(7)1619..1681
Misc Feature(8)1703..1765
Misc Feature(9)1829..1891
Misc Feature(10)2003..2065
Misc Feature(11)2102..2164
Misc Feature(12)2183..2245
Exon (1)1..139
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (2)140..257
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (3)258..356
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (4)357..779
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (5)780..912
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (6)913..1060
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (7)1061..1192
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (8)1193..1309
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (9)1310..1355
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (10)1356..1459
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (11)1460..1578
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (12)1579..1847
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (13)1848..1956
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (14)1957..2225
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Exon (15)2226..3813
Gene:GPR56
Gene Synonym:BFPP; BPPR; TM7LN4; TM7XN1
Translation MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIEN SEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLL CFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELK RDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKL QPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQ DKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGH WSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLV TIAAYLCSRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSL LTCLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPII LAVHRTPEGVIYPSMCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKW SHVLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQAR GGPSPLKSNSDSARLPISSGSTSSSRI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
207+dbSNP:
207+c, tdbSNP:151010444
281+c, tdbSNP:202128979
282+a, gdbSNP:112775979
306+c, tdbSNP:147879224
318+c, tdbSNP:200241873
319+a, gdbSNP:142223451
336+a, gdbSNP:144515150
358+dbSNP:
358+g, tdbSNP:369887735
364+c, tdbSNP:376180934
379+a, gdbSNP:145668224
404+c, tdbSNP:121908462
424+c, tdbSNP:12599906
453+a, tdbSNP:368183296
454+a, gdbSNP:143561619
466+c, tdbSNP:140963173
475+c, tdbSNP:200846541
476+a, gdbSNP:369918947
483+c, tdbSNP:199870082
495+a, c, gdbSNP:140781731
506+c, tdbSNP:144561715
528+a, gdbSNP:13338340
530+a, tdbSNP:372630305
535+c, tdbSNP:58068378
547+a, gdbSNP:375579694
555+a, gdbSNP:121908466
564+c, gdbSNP:121908465
578+c, tdbSNP:146278035
614+c, tdbSNP:145881545
665+c, gdbSNP:373091133
687..688+, cdbSNP:34819874
693+c, tdbSNP:138344683
694+a, gdbSNP:149607882
737+a, gdbSNP:144347830
739+c, tdbSNP:369913361
754+c, tdbSNP:373133040
755+g, tdbSNP:199910467
767+c, tdbSNP:199902692
777+a, gdbSNP:376287842
779+a, cdbSNP:373741981
792+dbSNP:
792+c, tdbSNP:377590979
796+c, tdbSNP:113005540
845+c, tdbSNP:138495764
856+g, tdbSNP:369147371
894+c, tdbSNP:374478592
895+a, gdbSNP:143113602
904+c, tdbSNP:147495708
905+a, c, gdbSNP:201006096
913+dbSNP:
913+a, gdbSNP:202000184
933+c, g, tdbSNP:114515505
976+c, tdbSNP:151214362
985+c, tdbSNP:371105408
994+c, tdbSNP:376931459
995+a, gdbSNP:139207635
1003+a, gdbSNP:148219127
1018+c, tdbSNP:371342603
1024+c, tdbSNP:374209597
1052+c, tdbSNP:368130981
1053+a, gdbSNP:145001300
1072+dbSNP:
1072+c, tdbSNP:371548509
1093+c, gdbSNP:141056936
1135+c, g, tdbSNP:1801257
1136+c, gdbSNP:146704802
1171..1172+, ttadbSNP:201811467
1210+dbSNP:
1210+a, cdbSNP:1801255
1269+c, tdbSNP:201754491
1277+a, gdbSNP:61744444
1288+c, tdbSNP:1376041
1302+c, tdbSNP:76355889
1309+a, gdbSNP:377565870
1328+dbSNP:
1328+a, tdbSNP:121908463
1365+dbSNP:
1365+c, tdbSNP:142015112
1371+a, gdbSNP:150233291
1396+c, tdbSNP:200032236
1414+a, gdbSNP:376119406
1416+c, tdbSNP:138890826
1480+dbSNP:
1480+c, tdbSNP:368883473
1485+c, tdbSNP:143257214
1517+a, gdbSNP:377084153
1526+a, gdbSNP:368180933
1529+a, gdbSNP:372354417
1531+c, gdbSNP:376948797
1562+a, gdbSNP:147479620
1589+dbSNP:
1589+c, tdbSNP:373065016
1591+a, gdbSNP:143798178
1613+a, tdbSNP:372478842
1615+g, tdbSNP:181901909
1621+c, gdbSNP:375495959
1630+c, tdbSNP:7198790
1631+a, gdbSNP:202092636
1644+a, gdbSNP:142684762
1648+a, gdbSNP:151020094
1664+a, gdbSNP:186550684
1707+c, gdbSNP:201132218
1728+c, gdbSNP:143407077
1752+c, tdbSNP:17379472
1754+a, gdbSNP:200680234
1783+c, tdbSNP:369114425
complement(1854)-dbSNP:
complement(1854)-t, cdbSNP:16958679
1860+g, tdbSNP:201202303
1869+c, tdbSNP:373179390
1939+c, tdbSNP:2278808
1957+dbSNP:
1957+g, tdbSNP:370457958
1967+c, tdbSNP:121908464
2033+a, gdbSNP:374754989
2040+c, tdbSNP:368619013
2067+a, g, tdbSNP:140298537
2072+c, tdbSNP:371152613
2097+a, gdbSNP:149868261
2102+c, tdbSNP:113358058
2108+c, gdbSNP:201661515
2257+a, gdbSNP:139927249
2258+c, tdbSNP:200285648
2259+a, gdbSNP:374044626
2268+c, gdbSNP:201080070
2271+a, gdbSNP:143389426
2275+c, tdbSNP:111939130
2283+c, tdbSNP:141728283
2308+c, tdbSNP:145354323
2317+a, cdbSNP:370613196
2329+a, gdbSNP:186736979
2365+c, gdbSNP:374394347
2375+a, cdbSNP:74022020
2387+c, tdbSNP:369262264
2394+g, tdbSNP:10852554
2401+c, tdbSNP:377047614
2402+a, gdbSNP:201611287
2430+a, c, gdbSNP:10852555
2454+c, tdbSNP:74022021
2464+a, gdbSNP:113439449
2495+a, gdbSNP:376254412
2510+a, gdbSNP:113137755
2544+a, gdbSNP:191543742
2545+g, tdbSNP:184796447
2547+c, gdbSNP:4784002
2552+c, tdbSNP:11556144
2554+g, tdbSNP:11556145
2606+c, g, tdbSNP:113562508
2657+c, tdbSNP:1823479
2660+a, cdbSNP:35572780
2770+g, tdbSNP:376945009
2837+c, tdbSNP:371098429
2905+c, tdbSNP:74573309
3120+a, gdbSNP:190451895
3147+c, tdbSNP:57937322
3188+c, tdbSNP:74520836
3197+g, tdbSNP:3211127
3218+c, tdbSNP:376360293
3266+c, tdbSNP:7191189
complement(3274)-t, cdbSNP:139681411
3284+a, gdbSNP:76377903
3363+a, g, tdbSNP:1043540
3414+c, tdbSNP:149861292
3425+a, gdbSNP:114876561
3458+c, tdbSNP:181632122
complement(3461)-g, adbSNP:145861349
complement(3484..3485)-c, adbSNP:12641
3576+a, cdbSNP:80206511
3595+c, tdbSNP:17240904
complement(3659)-c, adbSNP:15437
3680..3681+, adbSNP:367820683
3692+c, tdbSNP:139730624
3721+a, gdbSNP:115230856
3793+a, gdbSNP:3180467
Gene SymbolGPR56
Gene SynonymBFPP; BPPR; TM7LN4; TM7XN1
Chromosome16
Locus Map16q13
Title Evolutionarily dynamic alternative splicing of GPR56 regulates regional cerebral cortical patterning .
Author Bae BI, Tietjen I, Atabay KD, Evrony GD, Johnson MB, Asare E, Wang PP, Murayama AY, Im K, Lisgo SN, Overman L, Sestan N, Chang BS, Barkovich AJ, Grant PE, Topcu M, Politsky J, Okano H, Piao X and Walsh CA.
Journal Science 343 (6172), 764-768 (2014)
Title G-protein coupled receptor 56 promotes myoblast fusion through serum response factor- and nuclear factor of activated T-cell-mediated signalling but is not essential for muscle development in vivo .
Author Wu MP, Doyle JR, Barry B, Beauvais A, Rozkalne A, Piao X, Lawlor MW, Kopin AS, Walsh CA and Gussoni E.
Journal FEBS J. 280 (23), 6097-6113 (2013)
Title Maintenance of the hematopoietic stem cell pool in bone marrow niches by EVI1-regulated GPR56 .
Author Saito Y, Kaneda K, Suekane A, Ichihara E, Nakahata S, Yamakawa N, Nagai K, Mizuno N, Kogawa K, Miura I, Itoh H and Morishita K.
Journal Leukemia 27 (8), 1637-1649 (2013)
Title Promoter methylation profiles between human lung adenocarcinoma multidrug resistant A549/cisplatin (A549/DDP) cells and its progenitor A549 cells .
Author Guo R, Wu G, Li H, Qian P, Han J, Pan F, Li W, Li J and Ji F.
Journal Biol. Pharm. Bull. 36 (8), 1310-1316 (2013)
Title Dynamic regulation of a GPCR-tetraspanin-G protein complex on intact cells: central role of CD81 in facilitating GPR56-Galpha q/11 association .
Author Little KD, Hemler ME and Stipp CS.
Journal Mol. Biol. Cell 15 (5), 2375-2387 (2004)
Title G protein-coupled receptor-dependent development of human frontal cortex .
Author Piao X, Hill RS, Bodell A, Chang BS, Basel-Vanagaite L, Straussberg R, Dobyns WB, Qasrawi B, Winter RM, Innes AM, Voit T, Ross ME, Michaud JL, Descarie JC, Barkovich AJ and Walsh CA.
Journal Science 303 (5666), 2033-2036 (2004)
Title An autosomal recessive form of bilateral frontoparietal polymicrogyria maps to chromosome 16q12.2-21 .
Author Piao X, Basel-Vanagaite L, Straussberg R, Grant PE, Pugh EW, Doheny K, Doan B, Hong SE, Shugart YY and Walsh CA.
Journal Am. J. Hum. Genet. 70 (4), 1028-1033 (2002)
Title TM7XN1, a novel human EGF-TM7-like cDNA, detected with mRNA differential display using human melanoma cell lines with different metastatic potential .
Author Zendman AJ, Cornelissen IM, Weidle UH, Ruiter DJ and van Muijen GN.
Journal FEBS Lett. 446 (2-3), 292-298 (1999)
Title GPR56, a novel secretin-like human G-protein-coupled receptor gene .
Author Liu M, Parker RM, Darby K, Eyre HJ, Copeland NG, Crawford J, Gilbert DJ, Sutherland GR, Jenkins NA and Herzog H.
Journal Genomics 55 (3), 296-305 (1999)
Title Polymicrogyria Overview .
Author Chang,B., Walsh,C.A., Apse,K. and Bodell,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.